Conserved Protein Domain Family
PLN02635

?
PLN02635: PLN02635 
disproportionating enzyme
Statistics
?
PSSM-Id: 215341
Aligned: 17 rows
Threshold Bit Score: 906.44
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302809500   1 MVSSALSP------------------------------------------------------------------------ 8  
145342068   1 ----------------------------------------------------------------------------mgpv 4  
159489864   1 ----------------miplrapqgvrytqqidrsqqvlpqlrsrapqsvshvagsrravsrrsvrafawgtpkttgpap 64 
168001012   1 MAFSGLRGi----------------------------------------------------------------------- 9  
168034311   1 ----------------------------------------------------------------------mkkwklgvgi 10 
168016526  14 VGTPSLKSstwrwgersllpnkhnhalgstsrvwvervkrdypryftaspaavlsperldlspketdtnklgsgtydlkv 93 
242046386   6 VLTLPLPApssaphrrlllppqaspaparvrtvraaa--------------craanamaavsvdpppvapspaevaavgv 71 
255070977   1 ---------------------------------mawsllsnapslsthpssrrfclkwndsprsfrkirslrakasmlei 47 
302794450   1 MASSALSP------------------------------------------------------------------------ 8  
303273494   1 ---------------------------------------------msfahshqinflpnvprtlsanrtrrrvahtaaki 35 
302809500   9 GDDLPDEYEKDDPSKK-AMPRRAGIILHPTSLPGPHGIGDLGPDAFRFLDWLESTGCRIWQVLPLVPPgr----kaGEDG 83 
145342068   5 GQPVPNGYGDYYPTPR--DDRRAGVIMHPTSLPGAYGIGDAGPEARAFVDWMAKGKMSIWQVLPLVPPgrpipgvrEDYW 82 
159489864  65 GEVLGKDYDQKIPSYN--KGRRAGILLHPTSLPGPYGIGDIGDEAKRFVDWLADHGMQCWQLLPLVPPdp-------mYY 135
168001012  10 GDELPPDYADHDPKDT-RAQRRCGILLHPSSLPGEFGIGELGDEAFAFLDWLQSTGCTVWQVLPLGPPgr----kgGEDG 84 
168034311  11 GEDLPAKYQDDDPLKQ-APRRRCGILLHPTSLPGPNGIGDFGKDTYRFLDWLKETGCTVWQVLPLVPPgt----rgGEDG 85 
168016526  94 GDDLPANYADDDPNRM-KPERRCGVLLHPSSLPGPNGIGELGEETFAFLDWLASTGCTLWQVLPLVPPgr----kgGEDG 168
242046386  72 GDELPEGYDQMMPTVEpSRRRRAGVLLHPTSLRGPHGIGDLGDEALAFLHWLRDAGCTLWQVLPLVPPgr----taGEEG 147
255070977  48 GEPVHDGYTEMLPPRR--AQRRAGVIMHPTSLPGHYGIGDLGKEAFAFIDWLADAKMQVWQILPLVPPgrpipgfrEDYW 125
302794450   9 GDDLPDEYEKDDPSKK-AMPRRAGIILHPTSLPGPHGIGDLGPDAFRFLDWLESTGCRIWQVLPLVPPgr----kaGEDG 83 
303273494  36 GEPVERGYIDSLPPDR--AARRAGIIMHPTSLPGRYGIGDMGREAYAFVDWLASAKMQIWQVLPLVPPgrpipgirEDYW 113
302809500  84 SPYAGQDANCGNTLLISLTELVKDGLLEEEDIPEAIP-VEKINYEAVAELKDPLIQKAAKNLVQ-NG-GSLKKDLENFR- 159
145342068  83 SPYSGRDAHCGNTLVISLDDLVADGLLETKDLPKAYGgSENVDFGRVAATNEPLIAKAAEKLLAmASgSGLKGEYDAFC- 161
159489864 136 SPYSGTDANCGNPLVVSIEELIKDGLLEFSETPPRVP-IADVDYPAVAAAKLPLLKRAAQRLLKeDRfTRLREEYLKYRk 214
168001012  85 SPYAGADANCGNPLLLSLHELVKDGLLEISDLPAPLP-FGKVDFEAVAKMKDPLIAKASINLVN-SS-DPLREDLDKFR- 160
168034311  86 SPYAGSNANCGNTLLISLEELVKDGLLEKTDLPKPLP-VKRMDSSKVAAIKNPLILKAAAKLVSkSS-GKLKEELERFR- 162
168016526 169 SPYAGVDANCGNTLLISLEELVKDGLLEEIDLPSPVP-LGKVDFDAVARIKDPLIAKAARNLVS-SR-GAMREELDRFR- 244
242046386 148 SPYSGQDANCGNTLLLSLEELVKDGLLMSDELPDPVD-TEYVEFDTVANLKEPLIAKAAERLLL-SH-GELRTQYDCFK- 223
255070977 126 SPYSGRDAHCGNTLIISLDELVADGLLTEQELPQPYNlSGNVDFSRVAEINEPLIARAAKRLLErSDdDSLKSSLATWR- 204
302794450  84 SPYAGQDANCGNTLLISLTELVKDGLLEEEDIPEAIP-VEKINYEAVAELKDPLIQKAAKNLVQ-NG-GSLKKDLETFR- 159
303273494 114 SPYSGRDAHCGNTLIISLDELVKEGLLASGELPEESSlLSNVDFQKVAEVNEPLISIAARRLLNkPNtDPMKLAFNEWR- 192
302809500 160 KSPQIASWLEEAALFAAIDSH--FDDGAWWQWPEPLRDRNPSALDKARKEHKDFIDVFIAQQFLFQKQWQALHTYANERG 237
145342068 162 ARADVKAWLDPAATFDAIDSTpeLLGKYWWDWPAEYRDRDPGALAAIESEKASSIELFKATQFLFHVQWMRLKKYANDRG 241
159489864 215 EHP----WVEDSALFDVARNLpeLSQLAWWQWPEPLRLRQKEALKEFRETNKDAIDEFVVIQYFFEKQWKAIRSYANGKG 290
168001012 161 TNPQISTWLETSALFAAIDDA--IGAQYWWQWPEELRDRNTQALESAREKYHNFITQFIAVQFLFQRQWQAVHQYANSIG 238
168034311 163 KDPKISVWLEDAALFASIDQC--TLAKTWWTWPTQLRDRDPNAMKTVRIKHKSDIDNFIAAQFLFHRQWQSVHKYANAAG 240
168016526 245 TDLRISSWLEEAALFAAIDNV--IDAKHWWDWPEDLRDRNAEALEAFRKEHHGFITQFVAEQFLFQRQWQAVHKHANALG 322
242046386 224 KNPNISGWLEDAALFAAIDKS--IGAFSWYEWPEPLKNRHLGALEDIYQKQKDFIETFMAQQFLFQRQWQRVRKYAQKLG 301
255070977 205 SRPEIKSWIEEAALFDAICNDpnLVGKDWWDWPEDLRRRDPAKLEQKRASAAAHIEEFCATQFLFDKQWLKLKTYANSQG 284
302794450 160 KSPQIASWLEEAALFAAIDSH--LDDGAWWLWPEPLRDRNPSALDKARKEHKDFIDVFIAQQFLFQKQWQALHTYANERG 237
303273494 193 VRLEISSWLNEAALFDAICHEpdNIGKDWWDWPDAFRRREPAALEAKRAASAAYIDEFCATQFIFDRQWLALKNYANLKG 272
302809500 238 IKIIGDMPIYVGGHSADVWVHRTQFMMDeKTCEPVLVSGVPPDCFSETGQLWGSPLYNWKAMAKDGYKWWASRMKRAFEL 317
145342068 242 VSLVGDMPIYVGGHSADVWANQNLFLLG-DDKRPSALAGVPPDAFSEDGQLWGNPLFDWGEHARTDYAWWAQRLKRTLEL 320
159489864 291 IKLIGDMPIYVGGHSADVWANRHLFELN-EAGLPEQVSGVPPDAFSATGQLWGSPLYKWPAHKKEGFKWWTARMARTLEL 369
168001012 239 IRIIGDMPIYVGGHSADVWANRQMFELDpQTGAPAMVSGVPPDAFSETGQLWGSPLYNWKEMAKDRYSWWVKRMRRAFEL 318
168034311 241 IKILGDMPIYIGGHSADVWAHRALFELDpKTGVPMQVSGVPPDAFSATGQLWGSPLYNWKEMAKDRYAWWATRLRRAYEL 320
168016526 323 IRIVGDMPIYVGGHSGDVWANREMFELDpSTGAPAMVSGVPPDAFSETGQLWGSPLYDWKAMAEDGYSWWANRMRRAFEL 402
242046386 302 ISIMGDMPIYVGYHSADVWANRKSFLLD-KNGFPTFVSGVPPDAFSETGQLWNSPLYDWKAMEADGFSWWTKRIKRALDL 380
255070977 285 ISIIGDMPIYVGGHSADVWANQSLFLLG-DDFKPTSVAGVPPDAFSEDGQLWGNPLYDWRSHSQENYRWWAGRIGRALQL 363
302794450 238 IKIIGDMPIYVGGHSADVWVHRTQFMMDeKTCEPVLVSGVPPDCFSETGQLWGSPLYNWKAMAKDGYKWWASRMRRAFEL 317
303273494 273 ISIVGDMPIYVGGHSADVWANQALFSLG-PDCKPLAVAGVPPDAFSEDGQLWGSPLYDWPMHDAHGYKWWAGRLGRALEL 351
302809500 318 YDEFRIDHFRGLAGYWAVPADAETAIDGRWKMGPRVEFFNAIKKAVGkKIDIIAEDLGIITTDVVELRKAIEAPGMVVLH 397
145342068 321 HDEVRIDHFRAFAAYWEVEAGAPTAKSGRWMVGPGVDMFNKLKPALG-DAKIVAEDLGVITADVVDLRQECGFPGMVVLQ 399
159489864 370 YDECRIDHFRGFAGYWSVDANETTAMNGNWRQGPGLELFTAMKKALG-AVPILAEDLGVITTDVVALREAIGAPGMVVLQ 448
168001012 319 FDEFRIDHFRGLGGYWAVDAASDTALNGKWLQGPGEDFFNAIRDAVG-KLDIIAEDLGVLTPDVLALRKKIHAPGMAVLQ 397
168034311 321 YDEFRIDHFRAFAGYWAIPATAQNAMGGKWKAGPGSAFFTAMREAVG-KIDVIAEDLGIITGDVIALRKEIKAPGMAVLQ 399
168016526 403 YDEFRIDHFRGLAGYWAIDAAEDTAMHGKWQKGPGEEFFSAIRAAVG-KVDIIAEDLGVITSDVVSLRKNINAPGMAVLQ 481
242046386 381 YDEFRIDHFRGLAGFWAVPSDAKVALVGSWRAGPRNSFFDALFKAVG-RINIIAEDLGVITEDVVQLRKSIGAPGMAVLQ 459
255070977 364 HDEVRIDHFRAFAAYWSVPASAKTAKNGSWIVGPGKSFFDGVEKVVG-DAPIVAEDLGVITKDVVDLREAIEAPGMVVLQ 442
302794450 318 YDEFRIDHFRGLAGYWAVPADAETAIDGRWKMGPRVEFFNAIKKAVGkKIDIIAEDLGIITTDVVELRKAIEAPGMVVLH 397
303273494 352 HDEVRIDHFRAFAAYWSVPADAKTAKSGEWIVGPGEKFFKGIKDALG-DAPIVAEDLGVITKDVVELREAIGAPGMVVLQ 430
302809500 398 FAFGNNPKNPHILHNHEVDQVVYPGTHDNDTSVGWWSKASEEDKEKARTYLRLEDEDAISWELMRAAFSSVARTAIIPMQ 477
145342068 400 FAWGGNGRNPHLLHNHYENSFCYPGTHDNETSQGWYAQQDEDTKRRLEAYAGIAYGDG-AWGMIKAGMSSVSKACVFTMQ 478
159489864 449 FAWGGGPGNVHLPHNHYENCFVYPGTHDNETAVGWFRGSANDTDKSYIKSYLRTDGGDIAWDFIRACMAAVPRTCVIMMQ 528
168001012 398 FAFGGDADNSHLPHNHDVDLVIYTGTHDNDTVVGWWTKVGQAEGNHVRQYFKIESDKDVHWELIKGALSSVGLTAILPMQ 477
168034311 400 FAFSDNAANPHLPHNHELDQVVYPGTHDNDTCVGWWKKASDAEKQVARAHLRFEGDADVHWEFIRGAVASVARTSIVSMQ 479
168016526 482 FAFGSDSMNPHLPHNHEVDQVVYSGTHDNDTVVGWWKKATTSEREHVLQYMGLKSDENIHWEFIKCALSSVALTTIIPMQ 561
242046386 460 FAFGGGSDNPHLPHNHEMDQVVYTGTHDNDTVLGWWQNLPEEEKKIVIKYLPEAENTDISWTLITAALSSVARTSMVTMQ 539
255070977 443 FAWGGDKQSPHLPHNFCENSFCYPGTHDNQTTEGWYENLDEATKVKLANYAGISDAEGAAWGLIRLGMSSVSKACVFTMQ 522
302794450 398 FAFGNNPTNPHILHNHEVDQVVYPGTHDNDTSVGWWSKASEEDKEKARSYLRLEDEDAVSWELMRAAFSSVARTAIIPMQ 477
303273494 431 FAWGGDGHSPHLPHNHYENSFCYPGTHDNETTQGWYEQLDDTTKLFLSSYAGITETEGAAWGFIRLSMSSASKSCVFTMQ 510
302809500 478 DVLSLDSDARMNTPAVKSGNWAWRIGESSIFDELTEEGERIKELLHEYNRL 528
145342068 479 DVLALGNEARMNTPGVADGNWSWRIGEPGVFATLDAEAHKLASLATVYDRV 529
159489864 529 DVMRLDNTARMNTPGTAAGNWRWRMGDGNVWNSLKKEGEDLRKVAHDTNRL 579
168001012 478 DLLGLGSEARMNTPATVSGNWAWRVGEVGFFSGLKAETTKLKEILRFYHRY 528
168034311 480 DVMGLDSASRMNIPATQAGNWGWRVGESDVFESLGEETSRLRELMCRYHRA 530
168016526 562 DVLGLDDSARMNTPATQAGNWGWRIGEPGIFNELETEKRQLQLCLKLFNRY 612
242046386 540 DILGLDSSARMNTPATQKGNWRRRMPGSVGFDSLSPEAAKLKELLALYNRQ 590
255070977 523 DVLGLGDEARMNTPGVADGNWAWRIGPPGIFATCSPQAKKLASLATCFDRV 573
302794450 478 DVLSLDSDARMNTPAVKSGNWAWRIGESSIFDELTEEGERIRGLLHEYNRL 528
303273494 511 DVLGLDNTARMNTPGVARGNWAWRVHSPEIFAINGVEAMKLSKLAYLYARV 561
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap