Conserved Protein Domain Family
Alpha-mann_mid

?
smart00872: Alpha-mann_mid 
Click on image for an interactive view with Cn3D
Alpha mannosidase, middle domain
Members of this entry belong to the glycosyl hydrolase family 38, This domain, which is found in the central region adopts a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. The domain is predominantly found in the enzyme alpha-mannosidase.
Statistics
?
PSSM-Id: 214875
View PSSM: smart00872
Aligned: 117 rows
Threshold Bit Score: 74.8969
Threshold Setting Gi: 13541040
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

smart00872 is a member of the superfamily cl26658.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QWU_A        414 YWSGYYTSRPYHKRMDRVLMHYVRAAEML-SAWHSWD--GMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRM 490
gi 15613354   518 YHRGTYTSQAKMKKKNRQLEFSYRDAEIL-AVTASAEkgWDAYPGSSLEKGWKLLLLNQFHDIIPGSSIKEVYEDAAKDY 596
gi 116873451  516 YHRGTYTSQAFTKKMNRKIELGLRDSEWL-SVLAN-LkqGTTYPTEKLASIWQILLRNQFHDIIPGSSIKEVYDDALIEY 593
gi 56420437   518 YHRGTYTSQAYNKRMNRKMELLYRETEWMgIVSATLNsdWSRYPFERLNEGWKIILRNQFHDIIPGSSIREVYEDSREEY 597
gi 156742810  537 YHRGTYTSQARTKQNNRQAELLLREAEWL-NAWAVTHgaINR--QADLDAAWRTVLLNQFHDILPGSSVPLVYVESEQQF 613
gi 14590701   274 FHRGIFTTGAWIKRFNRLNEHLILQVEKL-YSL-LKIlyGIEYPWEGILNSWKAILLTQGHDALPASITKEVYDDVMRRs 351
gi 126464927  524 THRGAYTTDTCIKQKIWILDYLLRTLEQI-YTW--LYikGSSYPEEEINNLWKTLLLAEFHDVLSGTITYEVHKDICTKL 600
gi 126466036  271 FHRGTYTVGSFIKKLNRYNEELLLSIEKL-YTILNILf-NIEYPSI-VEKFWRLLLINQGHDALSATLSPNVYIEVRTRa 347
gi 48477163   493 YHRGVYTTNSHIKNYIASLSQELIIYDFL-NAF--NLlyNNKDNSESLIKSWKALLKSQFHDVLPGSANYYAYLEAFNEL 569
gi 13541040   513 NHRGVYTTNLEIKKYVANIEDKLIMLDFI-NSMi----yNSKLYISNTKKLWYGLLKAQFHDILPGSAYYYAYEEAFAEL 587
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap