2DOB


Conserved Protein Domain Family
SapB

?
smart00741: SapB 
Click on image for an interactive view with Cn3D
Saposin (B) Domains
Present in multiple copies in prosaposin and in pulmonary surfactant-associated protein B. In plant aspartic proteinases, a saposin domain is circularly permuted. This causes the prediction algorithm to predict two such domains, where only one is truly present.
Statistics
?
PSSM-Id: 214797
Aligned: 121 rows
Threshold Bit Score: 27.4561
Threshold Setting Gi: 74965975
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DOB_A         4 LPCDICKDVVTAAGDXLKDNAT-EEEILVYLEKTCDWLP-KPnXSASCKEIVDSYLPVILDIIKGEXSrPGEVCSALNLC 81  human
O35489       296 SECDLCLSVTTRAWNSSEL------ARPQAMHQACLSSP--L-DRQKCKQFVEQYTPQLLALEPRGGD-PRTTCQALGVC 365 Domestic guinea...
Q9BKM1       117 GICNMCQLLVTQVENWVESNDT-IMTLEKKLEQVCSVIP-GQ-YSALCTYAVEQYLPIFIHQVEKQFP-ALTICQDVHLC 192 Naegleria fowleri
Q18279       238 MSCFECTLSADALLQEFIDKR--QGTADDIQTVACNKMV-AN-WTDGCNDFVHMYMSTVLFLTYNQFD-GRGICTMMHSC 312 Caenorhabditis ...
Q18279       127 EVCDECQASTAQIGKLVGDEFTtYAVKSTLQRFVCKSAG--K-AHKACNIFVSSVIPDLMTEMKDMFTeKELMCSNMGLC 203 Caenorhabditis ...
BAG37452     297 SECHLCMSVTTQAG-----NSS-EQAIPQAMLQACVGSW-L--DREKCKQFVEQHTPQLLTLVPRGWD-AHTTCQALGVC 366 human
NP_680088    293 tECHFCKSVINQAW-----NTS-EQAMPQAMHQACLRFW-L--DRQKCEQFVEQHMPQLLALVPRSQD-AHITCQALGVC 362 house mouse
NP_741465    260 MSCFECKFVVEDMQTDMITNRK--KLSDDVRDFACYKIVtAN-MTDSCIDFLDLYLPTVIQMTVEQAT-PQGVCLANKCC 335 nematode
NP_741465    137 IVCDECQFVVKELKTVVEDKKSqAEARDFLRENVCKSLG--Q-YRGFCDLVVDEYLPQFIQELDAILQdPHQVCVDIKAC 213 nematode
NP_001075812 285 PECRLCMSVTTQARNISEQ------TRPQAVYHACLSSQ--L-DKQECEQFVELHTPQLLSLLSRGWD-ARAICQALGAC 354 rabbit
O35489       296 SECDLCLSVTTRAWNSSEL------ARPQAMHQACLSSP--L-DRQKCKQFVEQYTPQLLALEPRGGD-PRTTCQALGVC 365 Domestic guinea...
Q9BKM1       117 GICNMCQLLVTQVENWVESNDT-IMTLEKKLEQVCSVIP-GQ-YSALCTYAVEQYLPIFIHQVEKQFP-ALTICQDVHLC 192 Naegleria fowleri
Q18279       238 MSCFECTLSADALLQEFIDKR--QGTADDIQTVACNKMV-AN-WTDGCNDFVHMYMSTVLFLTYNQFD-GRGICTMMHSC 312 Caenorhabditis ...
Q18279       127 EVCDECQASTAQIGKLVGDEFTtYAVKSTLQRFVCKSAG--K-AHKACNIFVSSVIPDLMTEMKDMFTeKELMCSNMGLC 203 Caenorhabditis ...
BAG37452     297 SECHLCMSVTTQAG-----NSS-EQAIPQAMLQACVGSW-L--DREKCKQFVEQHTPQLLTLVPRGWD-AHTTCQALGVC 366 human
NP_680088    293 tECHFCKSVINQAW-----NTS-EQAMPQAMHQACLRFW-L--DRQKCEQFVEQHMPQLLALVPRSQD-AHITCQALGVC 362 house mouse
NP_741465    260 MSCFECKFVVEDMQTDMITNRK--KLSDDVRDFACYKIVtAN-MTDSCIDFLDLYLPTVIQMTVEQAT-PQGVCLANKCC 335 nematode
NP_741465    137 IVCDECQFVVKELKTVVEDKKSqAEARDFLRENVCKSLG--Q-YRGFCDLVVDEYLPQFIQELDAILQdPHQVCVDIKAC 213 nematode
NP_001075812 285 PECRLCMSVTTQARNISEQ------TRPQAVYHACLSSQ--L-DKQECEQFVELHTPQLLSLLSRGWD-ARAICQALGAC 354 rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap