1XBR,2X6U,1H6F


Conserved Protein Domain Family
TBOX

?
smart00425: TBOX 
Click on image for an interactive view with Cn3D
Domain first found in the mice T locus (Brachyury) protein
Statistics
?
PSSM-Id: 214656
View PSSM: smart00425
Aligned: 39 rows
Threshold Bit Score: 156.659
Threshold Setting Gi: 115533912
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XBR_A         2 LKVSLEE-RDLWTRFKELTNEMIVTK-N-GRRMFPVLKVSMSGLDPNAMYTVLLDFVAADNHR--WKYVN----G--EWV 70
gi 17556889   56 PNVELVN-RNLWSTFLECGTEMIITK-K-GRRMFPLVKLKLSGLDKNSNYTIIMEMISVDKLR--YKFWN----G--NWI 124
gi 482221    144 VTLREDQ-DKLWNLFHYHKNEMIVTK-S-GRKMFPKLEYVVRGLTPNKLYAMMLHIEPSDDHR--YKFSS----G--EWV 212
gi 71990575    6 VSIEGSQ-ETLWKIFHAEVNEMIVTK-N-GRKLFPKLEYIVEGLDENKLYAIMLQLQPVGESR--FKFSG----G--KWQ 74
gi 17553368    7 VTLSSTT-DPLWRSCHEYDNEMVITV-N-GRRIFPTLEYTVTGLDTFKLYSMCMHLDLVDDKK--LRFTG----G--QWA 75
gi 17552286   10 IKVSLST-PEIWEEFYPK-TEMIVTR-NrGRVIFPHLDYIIKGLDPGSLYSIYIHLERVDGIK--YKFDA----G--EWK 78
gi 17533367  167 VKISLAN-QEQWAKFHEIGTEMMVFN-S-GRRLFPLLAYKVSGLDPHKLYCAGVHMIPDSAYKqeYDHDL----Q--QWV 237
gi 17544678   25 IEISEIT-KKQWNQLIGI-HEVVVYK-D-CRKLFPAAKFSVRGLDPALLYSVEICFDVLSPFT--FSYNK----KleKWI 94
gi 193211307  15 IQVNVIG-SS--RTSDDHFLEQMLTKrK-KTNISQDLHYTLLGLNPRDLYQISIKLARIDEKK--YKFNGnfngG--DYY 86
gi 17556328  117 VTVTLQDpQDLWKELHYLSNEQNVLN-N-GRKIFPALNYKVEHLNPESNYKVEILLRRMVPYQ--IQYSN----G--SWS 186
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XBR_A        71 PGGKPEPQAP-SCVYIHPDSPNFGAHWMKDPVSFSKVKLTN---KMNGGGq----------------------------- 117
gi 17556889  125 VAGVGEHHPL-PTCFVHPQSPRSGEWWMTDGVDFKMAKLSNnpfNNDGHi------------------------------ 173
gi 482221    213 KSGKAEKHRE-PKKLWHADGVRSGKEWMTNPVCFDRVKITNc--aESTNAsm---------------------------- 261
gi 71990575   75 ETGKAEKQVD-AKKMWHADGVRKGSDWMWSSICFDRVKISNyseSNNASm------------------------------ 123
gi 17553368   76 ESVSTEKKDP-PRKVWHHNGSQTGKDWMLRNVSFDQIRITNrksKEDGNAsy---------------------------- 126
gi 17552286   79 EFAKGDPILP-IQYKEHPRGKRTGAEWMSEPVSFAHIKITNnpeIKDQKVi----------------------------- 128
gi 17533367  238 NCLNQKKTIFkPTSEILGRIEN-GFKLMSLGIDMSDVKIFNiaiRKKTPLqieksrk----------------------- 293
gi 17544678   95 PTKTPVNCQS-S--ALSSMICETGDWFMNGDMDFGALNITSsheKAKEKIeqnr-------------------------- 145
gi 193211307  87 PHKNSEIPMEdTEEIVHLDGYQTGARWMKTGVYFPKIGISKeqpDKERCL------------------------------ 136
gi 17556328  187 RKNVQSKKTIaMKTEKVFVGEFTGQDIMRTGLDLSDVKVFNigsDNKKKVtpyeemsdaekreydtqyskkktsmvgtak 266
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XBR_A       118 ---------------------------------iMLNSLHKYEPRIHIVRVGGTQRMIT-------------S------- 144
gi 17556889  174 ----------------------------------VLNSMHRYNPRFHIVRADSSGQPIL-------------Asl----- 201
gi 482221    262 ---------------------------------iFLHSMHKYTPVMSIYESPSESPFSV-------------Pqpstrlv 295
gi 71990575  124 ---------------------------------iYLNSMHKYIPVLTIYESPSESPFCV-------------Pqssnqiv 157
gi 17553368  127 ---------------------------------vHLLTQHRYIPVLTIYEGDQlv------------------------- 148
gi 17552286  129 ----------------------------------LVQSMHKHIPVVTVKQVRHYKTGYQ-------------Edfs---g 158
gi 17533367  294 ---------------------------pnldktiEVLIQYKYLPVIKIYELSNSGMEKK-------------Eia----- 328
gi 17544678  146 -------------------------------iavCLSSRTMYQIRVVLYEMQNDELIYlk-------------------- 174
gi 193211307 137 ----------------------------------LLESLHAYVPVLRFTTSSGISle----------------------- 159
gi 17556328  267 mwagvilsrsliqsltrtlslglsqsqslsltlsLTLSLNLYLILNLSLEVSNECKYIPvliineilpnqelRlv----- 341
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
1XBR_A       145 --HSFPETQFIAVTAYQNEEITALKIKHNPFAKAFLDAKERN 184
gi 17556889  202 ktFSFKETEFIAVTAYQNDVVTKCKIDNNPFAKGFRNIDTVR 243
gi 482221    296 tsVRLTYTEFIAVTAYQNDAVIKLKIKFNPFAKGFREGSQSD 337
gi 71990575  158 atAKFPHTEFIAVTAYQNQKITDLKIKHNSFAKGFRDGNLSR 199
gi 17553368  149 htARIPHSQFISVTAYHKGELNTLKTNNNPYSTGSRKDRRRE 190
gi 17552286  159 eqFRLEATEFMVVTAYQNEILKNLKVHHNKFASGFRSNGKRR 200
gi 17533367  329 -qATFPETSFVTVSIYRNQKIKEMKTLGNKYCRTDRKQIVME 369
gi 17544678  175 -eTKFDEMIFITCTEYRGQVNRELKKSMNRFSRKRKYEISGT 215
gi 193211307 160 -vTVWSQKFVTTMTSSNRSVKRREKRKLEETTGPSAKKTPEV 200
gi 17556328  342 geFENEITQFATVSSYKNHIVKALRTAANPTSRGDAKQEAVQ 383
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap