3OOI,1MVH,3DAL,2H21


Conserved Protein Domain Family
SET

?
smart00317: SET 
Click on image for an interactive view with Cn3D
SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain
Putative methyl transferase, based on outlier plant homologues
Statistics
?
PSSM-Id: 214614
Aligned: 80 rows
Threshold Bit Score: 43.4771
Threshold Setting Gi: 14596097
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OOI_A     92 PEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIr----------------------------------- 136  human
NP_593610   4 kynelvnqfapgakqitikkirkkgngifslnrytsgtvllevpleniicrktveqfrnscdkfasiatleewndmsfrt 83   Schizosaccharomyc...
AAK68776   43 lqyapllhqvnkrcrfllefeqeirrtledvkasdhpFSGQDvna----------------------------------- 87   thale cress
NP_015160 103 csehcrtsylqipniieliecyeillhhfpsmlkrynytseqeeklnsilisenviqsswdeieskwiprinnmksakri 182  Saccharomyces cer...
NP_499143 141 qltpfpeigeafkapaiqnaikrivesletdenwgrLDQisrtm------------------------------------ 184  nematode
NP_565457 138 dfqillslqgsgssngdpscsagdsaaagflhsLLSSVCPSLPVsisp-------------------------------- 185  thale cress
AAC53021    2 ENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINfvchtcfkrqeklhrcgqckfahycdrtcqkdawlnh 81   house mouse
AAB38131  213 llrrlftealyeeavsqwftpdgfrslfalvgtngqgigtSSLsqwvhacdtl--------------------------- 265  human
CAA15694  584 PNWTISSSTVAGRGVFATRDIAAGELIFQER-ALVTgptarkgqlsscicchetlpqtgflcrhrctlpvcetcsdseeh 662  fruit fly
CAA15694   42 PSWRVADSPISGRGIFATREIAAGEELFREHTLLVGPTAHRSMNlrtctlcyrlipgstdsaalcpagcglpvcsecrds 121  fruit fly
3OOI_A        --------------------------------------------------------------------------------      human
NP_593610  84 qamlflcylwlgiqprtnkwdkfltvlplsintpaqwpekevyslqgtsifnpvcvkrkilqqewlslnqrysdswpski 163  Schizosaccharomyc...
AAK68776   88 -------------------------------------------------------------------------------s 88   thale cress
NP_015160 183 nqlpptcedeyccirfvceslfnlkymdpqcityrafnmlqsnelskiskfpvllhfqklvfqtlyillpshlhrmlsip 262  Saccharomyces cer...
NP_499143 185 -----------------------------------------------------------------------------tft 187  nematode
NP_565457 186 -------------------------------------------------------------------------------d 186  thale cress
AAC53021   82 knecaaikkygkvpnenirlaarimwrveregtgltegclvsvddlqnhvehfgeeeqkelrvdvdtflqywppqsqqfs 161  house mouse
AAB38131  266 -------------------------------------------------------------------------elkpqdr 272  human
CAA15694  663 qaecehfrrwqpkdvdaeqeqvnpmslriltavrvfhlgkeqrhlvdamqanaerayrreiiqaaqcfrnfpttdrvfmd 742  fruit fly
CAA15694  122 trhdlecklfrkwkplesqrie--pralrilsvvrcffldeasrkllyamqanmdryymqevqraadcfehfpreqdmld 199  fruit fly
3OOI_A    137 -yAQEHDi----tNFYMLTLDk-----dRIIDAGp--------KGNYARFMNHCCQPNCETQKWSVNGdt---------r 189  human
NP_593610 164 tlPKWVHa----dALFHSRCLe-----sPFKDPVl---------aPVIDLCNHSSKSNAKWSFSEDa------------- 212  Schizosaccharomyc...
AAK68776   89 alGWTMSa----vSTRAFRLHgnkklqgGSSDDVp-------mMLPLIDMCNHSFKPNARIIQEQNGAdsn-------tl 150  thale cress
NP_015160 263 llRHILGtey-gnAFGLWQEG-------EASDSReyf---gywVFPEASYFNHSCNPNITKYRKGNs------------- 318  Saccharomyces cer...
NP_499143 188 kaLRIMAersaknAHTIYSi--------EQIESQednlpmatgLFPISSIFNHSCTPNISGFFVRN-------------- 245  nematode
NP_565457 187 ltAALLSkdk-vnaFGLMEPc------sVSNEKRsvr---aygIYPKTSFFNHDCLPNACRFDYVDSAsdg------ntd 250  thale cress
AAC53021  162 mqYISHI-------FGVINCNg-----fTLSDQRglqa-vgvgIFPNLGLVNHDCWPNCTVIFNNGNHeavksmfhtqmr 228  house mouse
AAB38131  273 ehVDAFI------DQLYKDIEaat-gefLNCEGSg--------LFVLQSCCNHSCVPNAETSFPENnf-----------l 326  human
CAA15694  743 qlFRIVGv----lNTNAFEAPcrsggheTLLRGLf----------PLTAIMNHECTPNASHYFENGRL------------ 796  fruit fly
CAA15694  200 yfYRTICa----fNTNAFESRsnvdgheVLVRALf----------PLAGLLNHQCTPNAAHHFENGET------------ 253  fruit fly
3OOI_A    190 VGLFALSDIKAGTELTFNYNLECLGN 215  human
NP_593610 213 MQLYLDKDIDENEEVTINYGSEKGSA 238  Schizosaccharomyces pombe 972h-
AAK68776  151 VKVVAETEVKENDPLLLNYGCLSNDF 176  thale cress
NP_015160 319 MLFTMNRDIKKDEQICIDYSGVLDLP 344  Saccharomyces cerevisiae S288c
NP_499143 246 TFIFVSQGVRAREELLDSYGVTYHQH 271  nematode
NP_565457 251 IIIRMIHDVPEGREVCLSYFPVNMNY 276  thale cress
AAC53021  229 IELRALGKISEGEELTVSYIDFLHLS 254  house mouse
AAB38131  327 LHVTALEDIKPGEEICISYLDCCQRE 352  human
CAA15694  797 AVVRAARDIPKGGEITTTYTKILWGN 822  fruit fly
CAA15694  254 IVVCATERIPAGAEITMSYAKLLWST 279  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap