Conserved Protein Domain Family
ABC_Rad50

?
cd03240: ABC_Rad50 
ATP-binding cassette domain of Rad50
The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Statistics
?
PSSM-Id: 213207
Aligned: 27 rows
Threshold Bit Score: 1e+06
Created: 11-Feb-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Comment:Walker A, Walker B, Q-loop, D-loop, and H-loop form the nucleotide binding site

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                         ## ###                                       
Q92878       4 IEKMSILGVRSfgiedKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGdfppgtkgntfvhdpkvaqetDVRAQIR 83   human
Q9HRW3       3 FTRLSLSNFKC-----YADAAVSLDPGVTVIHGLNGSGKSSLLDACFFALYGttaldttl------adavtigAETAEID 71   Halobacterium sa...
Q97WH0       3 IDKITLTNFLS-----HEHSEIQFMGEINVIVGQNGAGKSSIIDGIVFSLFRthsrgnn-------dnlirkgSNRGSVT 70   Sulfolobus solfa...
Q9HLR8       3 IDRIRLINFLS-----HEDSEIFFDTGVNIIVGHNGAGKSSIIDAIRFALFGdkrtkki-------edmirkgAKSLEVE 70   Thermoplasma aci...
Q58718       5 LKEIRMNNFKS-----HVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALFGagsnfny-------dtiitkgKKSVYVE 72   Methanocaldococc...
O58687       3 IERVIVQNFRS-----HKNSEIEFKPGINLIIGQNGAGKSSLLDAILVGLYWskrmrlrgl---kkdeftrtgTRGAIIE 74   Pyrococcus horik...
Q8TXI4       2 IERVKIENLRS-----HSSTEIEFREGINVLVGPNGAGKTTVLEAITLALFPrtfrsyd--------hmiregERRAVVE 68   Methanopyrus kan...
NP_248322    5 LKEIRMNNFKS-----HVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALFGagsnfny-------dtiitkgKKSVYVE 72   Methanocaldococc...
O29230       4 LKELQIKNFRS-----HSDSKIEFDTGINLIAGRNGAGKSSILEAILVAFYGlkpatlrk------ndlvrvnSSGYSLS 72   Archaeoglobus fu...
NP_634218    3 LKNLYIENIRS-----YKKLDFTFEDGVTVISGVNGSGKSSLLEACFMGLFGskilskdfv----ladmifkgAESAKIH 73   Methanosarcina m...
Feature 1                                                                                #     
Q92878      84 LQFRDVnGELIAVQRSMvctqkskktefktlegvitrtkhgekvslsskcaeidremisslgvskAVLNNVIFCHQEDSN 163  human
Q9HRW3      72 LHFEHA-GGDYHVHRRIrasggraqtaacvletptdr---------idgvtdveahisgllrmdaEAFVNCAYVRQGEVN 141  Halobacterium sa...
Q97WH0      71 LYLSNE-KDKIEIIRDIrsttedrlirnqfpiar--------------satvvsneiekilgidkDIALSTIIVRQGELD 135  Sulfolobus solfa...
Q9HLR8      71 MEFRHG-GHTYIIRRSItrrsknpesnamimvdgsal--------sqsvkdandyiekniitkskDVFLNSVFSKQGEMD 141  Thermoplasma aci...
Q58718      73 LDFEVN-GNNYKIIREYdsgrggaklykngkpyat-------------tisavnkavneilgvdrNMFLNSIYIKQGEIA 138  Methanocaldococc...
O58687      75 ITFEED-GTKYKVLRDFarnvsylkrldgrewrhv------------tetsmesvssfidriipyNVFLNAIYVRQGQID 141  Pyrococcus horik...
Q8TXI4      69 VVFWGAdGHKYKVRREFyrgggqrnprlyreegdgwkvv-----asgraedvdrevmnalggvdrDVFREAVYIRQGEIA 143  Methanopyrus kan...
NP_248322   73 LDFEVN-GNNYKIIREYdsgrggaklykngkpyat-------------tisavnkavneilgvdrNMFLNSIYIKQGEIA 138  Methanocaldococc...
O29230      73 LTFSLN-GDDYTISRKSngesiltgkeivegd-------------------snitewverhlcpaHVFTGAIYVRQGEID 132  Archaeoglobus fu...
NP_634218   74 LGFEHL-GREYLIEQAFryslksenasnsrcvlfadge------nivdqatrtyeevcallnmdeEAYRNCAYIRQGEID 146  Methanosarcina m...
Feature 1                                                                                      
Q92878     164 WPLsegkalkqkfdeifsatryikaletlrqvrqtqgqkvkeyqmelkylkqykekaceirdqitskeaqltsskeivks 243  human
Q9HRW3     142 KLInaapstrqdmidallqlgkleeyrqragdarlgvedvksnvegqldrladqiadkeaadphdrlashntalaevtad 221  Halobacterium sa...
Q97WH0     136 KILenfqeimgkilklelieklidsrgpivefrknlenklreldrieqdynnfkktveekrarvlelkkdkekledeikn 215  Sulfolobus solfa...
Q9HLR8     142 DLIsgdparrkklldeileiekleetydvlkdvidslqagisnldylisenerdrddlrryqddvaelskqidqeeaies 221  Thermoplasma aci...
Q58718     139 KFLslkpsekletvakllgidefekcyqkmgeivkeyekrleriegelnykenyekelknkmsqleeknkklmeindkln 218  Methanocaldococc...
O58687     142 AILesdetrdkivkeilnldklekaydnlgkirkyikysieekekfimkteniedlirtqeksftevlneirnissnlpr 221  Pyrococcus horik...
Q8TXI4     144 KLVeatreerkrivdrtlglaefkkareqahellrvaeakletfrervrdlkgskkelkrvereleelkrevkelepeve 223  Methanopyrus kan...
NP_248322  139 KFLslkpsekletvakllgidefekcyqkmgeivkeyekrleriegelnykenyekelknkmsqleeknkklmeindkln 218  Methanocaldococc...
O29230     133 SIIrddesreriirqitriedyenawknlgavirmlerekerlkeflsqeeqikrqkeekkaeieriseeiksieslrek 212  Archaeoglobus fu...
NP_634218  147 VLInakprdrqrmiddllqlgkleeyreragyaktavrrlerdaknsflgvkaeiegiestepvaavnrlrqkvketdai 226  Methanosarcina m...
Feature 1                                                                                      
Q92878     244 yeneldplknrlkeiehnlskimkldneikaldsrkkqmekdnseleekmekvfqgtdeqlndlyhnhqrtvrekerklv 323  human
Q9HRW3     222 iehfeaereqarqtrddaadvleryeesrtaladveetiadvreavaeaereretladrvsdhrerasdlddeaaalaad 301  Halobacterium sa...
Q97WH0     216 lekrikdikdqfdeyekkrnqylkltttlkikegelnelnrsieelrkqtenmdqlekeinelenlrniklkfekyevla 295  Sulfolobus solfa...
Q9HLR8     222 dllrkkeeasaeynavskelimldatlknmmslsdeanryeeeirkidgklqeisgsteryneitsskvyasrerirgyw 301  Thermoplasma aci...
Q58718     219 kikkefedieklfnewenkkllyekfinkleerkralelknqelkileydlntvvearetlnrhkdeyekykslvdeirk 298  Methanocaldococc...
O58687     222 lrrelegikeevktleatfnsitelklrlgelngkkgrleerirqlesgieekrkkskeleevvkelpelekketeyrrl 301  Pyrococcus horik...
Q8TXI4     224 elkerlnelreakreferlegelrllenkieslkgrrddlrklveegkeaerelqrlgdvpskvreleneeaelrrriee 303  Methanopyrus kan...
NP_248322  219 kikkefedieklfnewenkkllyekfinkleerkralelknqelkileydlntvvearetlnrhkdeyekykslvdeirk 298  Methanocaldococc...
O29230     213 lseevrnlesrlkeleehksrleslrkqessvlqevrgleeklrelekqlkevveriedlekkakevkelkpkaerysil 292  Archaeoglobus fu...
NP_634218  227 leelnkkkefaaarkgeldlriaeyrerlqeievlkqairksqedkaacfkeketfseevqvqrrvllelgeensgmree 306  Methanosarcina m...
Feature 1                                                                                      
Q92878     324 dchreleklnkesrllnqeksellveqgrlqlqadrhqehirardsliqslatqleldgfergpfserqiknfhklvrer 403  human
Q9HRW3     302 lglddpdaedasaerdavadqreavaervrevapavsrlteqadsaaddaatlderaetlreeaaaldaeaddaaakrdd 381  Halobacterium sa...
Q97WH0     296 kshtemsanvinlekeieeyekairrkeelepkylkykelerkleelqpkyqqylklksdldsklnlkerlekdaselsn 375  Sulfolobus solfa...
Q9HLR8     302 tdkgqiidyrkmlknidgqvqsyednmkkaaelqadhdqyeimqrrmdeikhelddlrtyeskyvslineieqkkkkree 381  Thermoplasma aci...
Q58718     299 iesrlrelkshyedylkltkqleiikgdieklkefinkskyrddidnldtllnkikdeiervetikdlleelknlneeie 378  Methanocaldococc...
O58687     302 iefkdeylvkknelekrlgilsnrlqevkrkikdaeskvarirwieerlkeiqekimkleprvrefedamrlkaqmeslk 381  Pyrococcus horik...
Q8TXI4     304 lrnllddlrslrnrlesaeeelegvkreleelkdeagvdperlvefkdkiveaserlrdlrreeelkrklekvsdelsel 383  Methanopyrus kan...
NP_248322  299 iesrlrelkshyedylkltkqleiikgdieklkefinkskyrddidnldtllnkikdeiervetikdlleelknlneeie 378  Methanocaldococc...
O29230     293 ekllseinqalrdvekregdltreaagiqaqlkkaeednskleeitkrieelerelerfekshrlletlkpkmdrmqgik 372  Archaeoglobus fu...
NP_634218  307 cgfgdleiealllqqeksessarekvnsgskelalllkeeetgvqalrelekdkvetervlvecrtsigaankeiegyra 386  Methanosarcina m...
Feature 1                                                                                      
Q92878     404 qegeaktanqlmndfaeketlkqkqideirdkktglgriielkseilskkqnelknvkyelqqlegssdrileldqelik 483  human
Q9HRW3     382 aaariealdadieaamaafddapvafgaaeaflddataerdelrervatlradrqsaadrvaeaealldegkcpecgqp- 460  Halobacterium sa...
Q97WH0     376 didkvnsleqkveetrkkqlnlraqlakveslisekneiinnisqvegetcpvcgrpldeehkqkiikeaksyilqle-- 453  Sulfolobus solfa...
Q9HLR8     382 yrkkqkdlgdeisrtlgrafanaselvaiyeeirrdideintdlgnlqvkigalrqkeeeirrnmnmleghnkcpvcgtd 461  Thermoplasma aci...
Q58718     379 kiekykriceeckeyyekyleleekaveynkltleyitllqekksieknindletrinklleetknidiesienslkeie 458  Methanocaldococc...
O58687     382 sklgglepekinekllylenrkkeleeeidkitrkigelnqrskdrrlaiielkkargkcpvcgrelteehkadllrkys 461  Pyrococcus horik...
Q8TXI4     384 gdreetlqseyeelqerldeiqgelkeirvkekellerieslreaegecpvclrklpreraekllrdaekelerlqgr-- 461  Methanopyrus kan...
NP_248322  379 kiekykriceeckeyyekyleleekaveynkltleyitllqekksieknindletrinklleetknidiesienslkeie 458  Methanocaldococc...
O29230     373 akleeknltpdkvekmydllskakeeekeiteklkkliakksslktrgaqlkkaveelksaertcpvcgreldeehrkni 452  Archaeoglobus fu...
NP_634218  387 nikqleeenkrlrekagfgaageiasvikeleekesllrdrknevstklgfalkekesgdaslreldsemqscrvavskg 466  Methanosarcina m...
Feature 1                                                                                      
Q92878     484 aerelskaeknsnvetlkmevislqnekadldrtlrkldqemeqlnhhtttrtqmemltkdkadkdeqirkiksrhsdel 563  human
Q9HRW3         --------------------------------------------------------------------------------      Halobacterium sa...
Q97WH0         --------------------------------------------------------------------------------      Sulfolobus solfa...
Q9HLR8     462 lgdegsrri----------------------------------------------------------------------- 470  Thermoplasma aci...
Q58718     459 ekkkvlenlqkekielnkklgeinseikrlkkildelkevegkcplcktpidenkkmelinqhktql------------- 525  Methanocaldococc...
O58687     462 le------------------------------------------------------------------------------ 463  Pyrococcus horik...
Q8TXI4         --------------------------------------------------------------------------------      Methanopyrus kan...
NP_248322  459 ekkkvlenlqkekielnkklgeinseikrlkkildelkevegkcplcktpidenkkmelinqhktql------------- 525  Methanocaldococc...
O29230     453 maeytremk----------------------------------------------------------------------- 461  Archaeoglobus fu...
NP_634218  467 kseiealekeirdnskavldfqeqksevfaglkalgfteeqlenledfnelllenknrlhgkekelevtlreientlrkn 546  Methanosarcina m...
Feature 1                                                                                      
Q92878     564 tsllgyfpnkkqledwlhskskeinqtrdrlaklnkelasseqnknhinnelkrkeeqlssyedklfdvcgsqdfesdld 643  human
Q9HRW3         --------------------------------------------------------------------------------      Halobacterium sa...
Q97WH0         --------------------------------------------------------------------------------      Sulfolobus solfa...
Q9HLR8         --------------------------------------------------------------------------------      Thermoplasma aci...
Q58718         --------------------------------------------------------------------------------      Methanocaldococc...
O58687         --------------------------------------------------------------------------------      Pyrococcus horik...
Q8TXI4         --------------------------------------------------------------------------------      Methanopyrus kan...
NP_248322      --------------------------------------------------------------------------------      Methanocaldococc...
O29230         --------------------------------------------------------------------------------      Archaeoglobus fu...
NP_634218  547 rellaegkcp---------------------------------------------------------------------- 556  Methanosarcina m...
Feature 1                                                                                      
Q92878     644 rlkeeieksskqramlagatavysqfitqltdenqsccpvcqrvfqteaelqevisdlqsklrlapdklksteselkkke 723  human
Q9HRW3         --------------------------------------------------------------------------------      Halobacterium sa...
Q97WH0         --------------------------------------------------------------------------------      Sulfolobus solfa...
Q9HLR8         --------------------------------------------------------------------------------      Thermoplasma aci...
Q58718         --------------------------------------------------------------------------------      Methanocaldococc...
O58687         --------------------------------------------------------------------------------      Pyrococcus horik...
Q8TXI4         --------------------------------------------------------------------------------      Methanopyrus kan...
NP_248322      --------------------------------------------------------------------------------      Methanocaldococc...
O29230         --------------------------------------------------------------------------------      Archaeoglobus fu...
NP_634218      --------------------------------------------------------------------------------      Methanosarcina m...
Feature 1                                                                                      
Q92878     724 krrdemlglvpmrqsiidlkekeipelrnklqnvnrdiqrlkndieeqetllgtimpeeesakvcltdvtimerfqmelk 803  human
Q9HRW3         --------------------------------------------------------------------------------      Halobacterium sa...
Q97WH0         --------------------------------------------------------------------------------      Sulfolobus solfa...
Q9HLR8         --------------------------------------------------------------------------------      Thermoplasma aci...
Q58718         --------------------------------------------------------------------------------      Methanocaldococc...
O58687         --------------------------------------------------------------------------------      Pyrococcus horik...
Q8TXI4         --------------------------------------------------------------------------------      Methanopyrus kan...
NP_248322      --------------------------------------------------------------------------------      Methanocaldococc...
O29230         --------------------------------------------------------------------------------      Archaeoglobus fu...
NP_634218  557 ----------------------------------------------------------------tcgqelkgsgiactae 572  Methanosarcina m...
Feature 1                                                                                      
Q92878     804 dverkiaqqaaklqgidldrtvqqvnqekqekqhkldtvsskielnrkliqdqqeqiqhlksttnelkseklqistnlqr 883  human
Q9HRW3     461 ----------------------------------------------------------------------------vega 464  Halobacterium sa...
Q97WH0     454 -----------------------------------------------------------------------------lnk 456  Sulfolobus solfa...
Q9HLR8     471 -----------------------------------------------------------------rehysedlnrlneei 485  Thermoplasma aci...
Q58718     526 --------nnkyteleeinkkireiekdieklkkeidkeenlktlktlylekqsqieelelklknykeqldeinkkisny 597  Methanocaldococc...
O58687     464 ------------------------------------------------------------------------lssiekei 471  Pyrococcus horik...
Q8TXI4     462 -----------------------------------------------------------------------------eed 464  Methanopyrus kan...
NP_248322  526 --------nnkyteleeinkkireiekdieklkkeidkeenlktlktlylekqsqieelelklknykeqldeinkkisny 597  Methanocaldococc...
O29230     462 ------------------------------------------------------------------riaeelakadeiek 475  Archaeoglobus fu...
NP_634218  573 eceekkeklsleladiklqraelekklnrlkeakklekqaydydieiekllekakaseklidthrtrieedslklessgk 652  Methanosarcina m...
Feature 1                                                                                      
Q92878     884 rqqleeqtvelstevqslyreikdakeqvsplettlekfqqekeelinkkntsnkiaqdklndikekvknihgymkdien 963  human
Q9HRW3     465 phvervtddrervaeldaeladvedeldavaqrvdrgeslvaaedrvddleqqreraverrdeqadiadakrdqaaekrd 544  Halobacterium sa...
Q97WH0     457 neleeelkkitnelnkiereyrrlsnnkasydnvmrqlkklneeienlhseieslknideeikkineevkelklyyeefm 536  Sulfolobus solfa...
Q9HLR8     486 dhlereasaidekkrqlismesylakgkireyetydrqmkdleaqitddenslstiaykhtkyeqldeeyrsmhledlrq 565  Thermoplasma aci...
Q58718     598 vingkpvdeilediksqlnkfknfynqylsavsylnsvdeegirnrikeienivsgwnkekcreelnklredereinrlk 677  Methanocaldococc...
O58687     472 qeakalerqlraefrkvenelsrlsslktiadqiieirerlskinledlkrdkeeyellksesnklkgeveslkkevnel 551  Pyrococcus horik...
Q8TXI4     465 lrkerrelkdrlesvrrelegtkermwrlrerreelereleeieelkeeladlsrelgveedrlpelrdlavraesllrd 544  Methanopyrus kan...
NP_248322  598 vingkpvdeilediksqlnkfknfynqylsavsylnsvdeegirnrikeienivsgwnkekcreelnklredereinrlk 677  Methanocaldococc...
O29230     476 klkerlekvekalekqetvlkyrqmvdelkalenelsshdaeklsaeseeyrkvkerldglrgqqkillssasrikelks 555  Archaeoglobus fu...
NP_634218  653 rkqeleaagskllldikalreqekaaqkvhlesekalreakvferklaenaseieslngkirtslalienygqrlgelne 732  Methanosarcina m...
Feature 1                                                                                      
Q92878     964 yiqdgkddykkqketelnkviaqlsecekhkekinedmrlmrqdidtqkiqerwlqdnltlrkrneelkeveeerkqhlk 1043 human
Q9HRW3     545 raadldaeaedaradaaakrdaadekretlaalnadqtalkerldaladlvdrleaaadareaaqrlaekraalaaqneq 624  Halobacterium sa...
Q97WH0     537 rlskytkeeldkkrvkldemkkkkeeiekemrgleselkgldrkaleskildlenkrvkldemkkkkgiledyirqvkll 616  Sulfolobus solfa...
Q9HLR8     566 kytdwnnamavisnigdiealrkqkdevskklkdaedrtheiesefpdinsytpsyigkiedevrllepqiklaedlkrq 645  Thermoplasma aci...
Q58718     678 dklnelknkekelieienrrslkfdkykeylgltekleelknikdgleeiynicnskilaidnikrkynkedieiylnnk 757  Methanocaldococc...
O58687     552 ndyknestkleieidkakkelseiedrllrlgfktidelsgrirelekfhnkyieaknaekelrdileslkdereeldka 631  Pyrococcus horik...
Q8TXI4     545 lerrrgdvlrlekelertldrcekvigrtpsgvedveeelrrleeerdhvgqklreaegeleryhnleekvkrarearke 624  Methanopyrus kan...
NP_248322  678 dklnelknkekelieienrrslkfdkykeylgltekleelknikdgleeiynicnskilaidnikrkynkedieiylnnk 757  Methanocaldococc...
O29230     556 slreieealknvesergelhrkireegfesleelerevqslrpfynkwlelkdaesrleselkrrekledeiseaiakle 635  Archaeoglobus fu...
NP_634218  733 klkafaeketqskeklealeltletarkneeeakkahiesarllgeakklqanllrmqnikhkisefeagignlaekigf 812  Methanosarcina m...
Feature 1                                                                                      
Q92878    1044 emgqmqvlqmksehqkleenidnikrnhnlalgrqkgyeeeiihfkkelrepqfrdaeekyremmivmrttelvnkdldi 1123 human
Q9HRW3     625 rrdrlselrerkrtldsefdadrietaradkdraedyleqvepklqalredrddlqakigaaenaiaeleslreehervq 704  Halobacterium sa...
Q97WH0     617 qeevknlreevniiqfdenrynelktsldaynlslkekenrksriegeleslekdieeisnrianyelqlkdrekiinai 696  Sulfolobus solfa...
Q9HLR8     646 retlrekvkdlrsrsagmdeiqkrknelsvkasesetrlkyvegqiqatlsslsgkrskvetlrshvseieqrisdrerd 725  Thermoplasma aci...
Q58718     758 ilevnkeindieerisyinqkldeinyneeehkkikelyenkrqeldnvreqkteietgieylkkdveslkarlkemsnl 837  Methanocaldococc...
O58687     632 feelakietdiekvtsqlnelqrkfdqkkyeekrekmmklsmeikgletkleelerrrdeikstieklkeerkeresakm 711  Pyrococcus horik...
Q8TXI4     625 lkrierdledakgrleqvernleglrerygsedrleeelesvekkyervrdklsevkgrlngmekrreelkkqvrkyrea 704  Methanopyrus kan...
NP_248322  758 ilevnkeindieerisyinqkldeinyneeehkkikelyenkrqeldnvreqkteietgieylkkdveslkarlkemsnl 837  Methanocaldococc...
O29230     636 eangkaeeirgqidellriyseeehrrlsdehlrkskelaglksrletlreslqsaekdlkfleeqlakmdeyrkkvevf 715  Archaeoglobus fu...
NP_634218  813 fdreiversdrirqlegklegnrleelqqklarfeeaqvnitekireitaekdtllkeigmienslkrlkelkeelkale 892  Methanosarcina m...
Feature 1                                                                                      
Q92878    1124 yyktldqaimkfhsmkmeeinkiirdlwrstyrgqdieyieirsdadenvsasdkrrnynyrvvmlkgdtaLDMRGRCSA 1203 human
Q9HRW3     705 srhqdlqavhdevtaletmygelraelrqqnvsklerllnetfelvyqndsyarielsgeyeltvyqkdgePLEPAQLSG 784  Halobacterium sa...
Q97WH0     697 nklekirsalgerklqsyiimttkqliennlndiiskfdlsiknvemeimpktgrgrsssgdilvytnsgdTLPIVSLSG 776  Sulfolobus solfa...
Q9HLR8     726 iermkkiekaindvkrireafgkngvpamirqsvsdyltaktrdylssfdldfddisvdqdfnvtvyrggvPEGIDSLSG 805  Thermoplasma aci...
Q58718     838 ekekekltkfveyldkvrrifgrngfqaylrekyvpliqkylneafsefdlpysfveltkdfevrvhapngVLTIDNLSG 917  Methanocaldococc...
O58687     712 eleklniaikrieelrgkikeykalikeealnkigeiaseifseftdgkysgiairaednkvklfviydgvERPLTFLSG 791  Pyrococcus horik...
Q8TXI4     705 kerkerlervvevlslckevfrysrdvarekvlpavereaskilqdlsdrygslrieddgavirvsvpgghFIEADRMSG 784  Methanopyrus kan...
NP_248322  838 ekekekltkfveyldkvrrifgrngfqaylrekyvpliqkylneafsefdlpysfveltkdfevrvhapngVLTIDNLSG 917  Methanocaldococc...
O29230     716 ekiaipeltrirekfrkyrnlvaensmreveryasqifeeltegkysgvrlkkttergkeklkvfvvyqgeEREIGFLSG 795  Archaeoglobus fu...
NP_634218  893 nkrlyleavynnadelentymrvradmrarnigalsillnemfsfmytnnayshieldpeynltvyrkdgtPLEPKLLSG 972  Methanosarcina m...
Feature 1                                         ##                                      #    
Q92878    1204 GQKVLASLIIRLALaetf--------clnCGIIALDEPTTNLDRENieslahaLVEIIKSRsqq--rnfQLLVITHDEDF 1273 human
Q9HRW3     785 GERALFNLSLRTAVyrllaeg--iegdapLPPLILDEPTVFLDSGHvs----qLVELVESMrrl--gveQIVVVSHDDEL 856  Halobacterium sa...
Q97WH0     777 GERIALSIALRLAIakal--------msnTNFFILDEPTIHLDDQRka----yLIEIIRAAkes---vpQIIVVTHDEEV 841  Sulfolobus solfa...
Q9HLR8     806 GEKTAVAFAIRVAVaqfl--------nadLSLLILDEPTAFLDEERrn----sLSDIIEYTlkdssvipQVIIISHHREL 873  Thermoplasma aci...
Q58718     918 GEQIAVALSLRLAIanal-------ignrVECIILDEPTVYLDENRra----kLAEIFRKVks----ipQMIIITHHREL 982  Methanocaldococc...
O58687     792 GERIALGLAFRLAMsmyl--------igkVDLLILDEPTPFLDEERrr----kLIEIMERHlrk---isQVIIVSHDEEL 856  Pyrococcus horik...
Q8TXI4     785 GEKIIIGLALRLALamvg--------ssfAPFIMLDEPTVHLDAEHre----rLAQALRELdlgkgrvrQAIVVTHDEEL 852  Methanopyrus kan...
NP_248322  918 GEQIAVALSLRLAIanal-------ignrVECIILDEPTVYLDENRra----kLAEIFRKVks----ipQMIIITHHREL 982  Methanocaldococc...
O29230     796 GEIIALGLAFRLALsmfm-------irgkIPLLILDEPTPFLDEERrr----kLVDITTNYlrk---ipQVIIVSHDEEL 861  Archaeoglobus fu...
NP_634218  973 GERAIFNLVLRCAIyrllalgfggdrpdgLPPMILDEPTVFLDRGHvr----qLLKLIDMMrsi--gvgQIIVVSHDESL 1046 Methanosarcina m...
Feature 1                                
Q92878    1274 VELLGrseyveKFYRIKKNId-QCSE 1298 human
Q9HRW3     857 VAAAD------DVVRVAKDAtsNRSR 876  Halobacterium salinarum
Q97WH0     842 VQAAD------YVIRVEKRG--NKSF 859  Sulfolobus solfataricus
Q9HLR8     874 LASAN------VAIEVKKIG--GRSV 891  Thermoplasma acidophilum
Q58718     983 EDVAD------VIINVKKDG--NVSK 1000 Methanocaldococcus jannaschii
O58687     857 KDAAD------HVIRIRLEG--GASK 874  Pyrococcus horikoshii
Q8TXI4     853 EDAAD------ELWRIENRA--GESR 870  Methanopyrus kandleri
NP_248322  983 EDVAD------VIINVKKDG--NVSK 1000 Methanocaldococcus jannaschii DSM 2661
O29230     862 KDAAD------KVIFVESQG--GVSR 879  Archaeoglobus fulgidus
NP_634218 1047 IDSAD------HVFQVEKDPltNMSS 1066 Methanosarcina mazei Go1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap