Conserved Protein Domain Family
PseudoU_synth_hTruB2_like

?
cd02868: PseudoU_synth_hTruB2_like 
Pseudouridine synthase, humanTRUB2_like.
This group consists of eukaryotic pseudouridine synthases similar to human TruB pseudouridine synthase homolog 2 (TRUB2). Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).
Statistics
?
PSSM-Id: 211345
View PSSM: cd02868
Aligned: 8 rows
Threshold Bit Score: 288.512
Threshold Setting Gi: 17543384
Created: 28-Jul-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
probable active
Feature 1:probable active site [active site]
Evidence:
  • Comment:predicterd active site based on similar proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
NP_001002200   3 GLFAVYKPQGVHWKLVRDTIESNFLKalnssppaaprrevqfqllssgen----stskelilspsmvpsladhplvtGPQ 78  zebrafish
NP_501102     23 GVLCVYKHSGISSAGLIKLITRKIAEsvsdiestsriqlplisipvieaheksgalvvvgrnevadyryhplvsgrsIRQ 102 nematode
AAH84478      14 GLFAVYKPPGVHWKSVRDTVETNLLKelnalkqrpprqqirflpagtegs---nglevtrvpsavpvladhvlvkgpAFT 90  western clawed ...
NP_610201     18 GILNVYKPSGMKVKHVRNAILSNICKglnemeqrkprklqenisllgtgta--adhvlhnigeqtdlsdhllstgprYLP 95  fruit fly
EAA01531      18 GVVNLYKPAGVTVQQVRNTIIHNLCRdlnqlevrpslqrvviennld---------aklvvrkvedlsdnvlvtgprYQP 88  Anopheles gambi...
NP_056494     11 GLFAVYKPPGLKWKHLRDTVELQLLKglnarkppapkqrvrfllgpmegs---eekeltltatsvpsfinhplvcgpAFA 87  human
XP_415502      7 GLFAVYKAPGVAWNRVRDAVEARLLRelnaaparpprsrirflpaasa-------gppglvavrvpvlaehrlvrgpRFT 79  chicken
XP_623484     21 GIFVIYKSPHIHFNAMRQTFIDNLCKdlndmyvrpqrkyvaiegetn---------knmkviirksfaddplvigprYQP 91  honey bee
Feature 1                 ####                                                                   
NP_001002200  79 FHKVHVGvgHRLDAFSSGVLVLGVGKGNSVLEHLCkshvTRDYTIEGEFGkatdnfshtgrviekttydhithdKLERVL 158 zebrafish
NP_501102    103 EDIQLVDv-LPLATNSSGVCLFGVNDGCESIPELMskswTNVYRIDGIIKksenidv-----------skiskhRIEKVL 170 nematode
AAH84478      91 HIRVGTG--HRLDIQSSGVFVLGIGHGNKLLKDMYnshfTRDYTVRGMLGkatedftelgktiekttydhitreKLERIL 168 western clawed ...
NP_610201     96 RDLICTTv-SSLGDHTSGVLLFGINRGAGQSSSIRknrpVRVYHLIGHLGiatennlpdsrvimrsnhrhvsadRISSLA 174 fruit fly
EAA01531      89 EDIKCRFc-ANHGRFTSGVIALGINNGTNLAFRLQqnrpLRVYRVTGFLGkatethfadsrvtaratishigseKIGRLL 167 Anopheles gambi...
NP_056494     88 HLKVGVG--HRLDAQASGVLVLGVGHGCRLLTDMYnahlTKDYTVRGLLGkatddfredgrlvekttydhvtreKLDRIL 165 human
XP_415502     80 QLKIGAG--HRLDVKASGVFVLGVGHGNKLLSHLYschlSKVYTVRGQFGkatedfsdtgkliekttfdhitreKLERIL 157 chicken
XP_623484     92 NDFKLAAt-KIMHKDISGVLVCGINKGNQLIHKIKenmcIRFYKIKGLLGqatdnyfhtgkivekskythikrgHIDKLC 170 honey bee
Feature 1                                                                                #       
NP_001002200 159 AMLQ-GSNQKALITYSQVDLQTQEAYelaargllYPDGKSPPILTGLRCIKFNP-PHFTLEVRCVNETQKYLRKLIHEVG 236 zebrafish
NP_501102    171 SRLEsEFRSASFRHANVDMESSEAFElar--rgvPRAQLPGSQIVYSIDLNWFRsPKFSVTTQCSGEDDEMLRQLIEHIG 248 nematode
AAH84478     169 AVIQ-GTNQKALITHSHLDLQSQEAYdlav-qgkLRPMVKSPPIILGIRCLEFSpPEFTLEIQCMHETQQYLRKMIHEIG 246 western clawed ...
NP_610201    175 ASMQaSHQRKMFELCGVDLQTQEAYElac--rglLRPADDSQPVVYGIKLIHFDrPHFTLELHAINETQEYLATLVHDMA 252 fruit fly
EAA01531     168 AAIQaSHQRKMFELSGIDIQSQAAYElac--kgtIRPADNRLPMIYGIRLAEYRkPFFTIEIHAINETEAYLGELIHEIG 245 Anopheles gambi...
NP_056494    166 AVIQ-GSHQKALVMYSNLDLKTQEAYemav-rglIRPMNKSPMLITGIRCLYFApPEFLLEVQCMHETQKELRKLVHEIG 243 human
XP_415502    158 AVIQ-GTNHKALLMHSHIDMKTQEAYelav-kglIRPMGKSPPIITAIRCLQFAlPEFQLEIHCLHETQQYLRKVVHEIG 235 chicken
XP_623484    171 SSMQsSHQKKMFELCGVDIQSQAAYElav--qgpIRPANSNIPMIYTIKCTDFSpPEFTLEVVCTNEYDLYLKTIIHELG 248 honey bee
Feature 1                                                
NP_001002200 237 LELLASAVCTKVRRTRDGPFKVENALTRQHWTADSVLQAI 276 zebrafish
NP_501102    249 SNLGTESTTIRLQRQNFGPFGSDNALLEKQINLQNIARNI 288 nematode
AAH84478     247 LELRSSAVCTQVRRSRDGPFTVDCSLLRTQWDLGSIQGAI 286 western clawed frog
NP_610201    253 LDLRTVAHCSQLRCVRHAHFDVTDSLLRHAWHLPGIIKNL 292 fruit fly
EAA01531     246 INLKSCAHCTGVRCIRHGHFLLEDSLLKKDWNLQNIISGM 285 Anopheles gambiae str. PEST
NP_056494    244 LELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAI 283 human
XP_415502    236 LELKSSAVCTQVRRTRDGVFTLDDALLRTQWNLQSIRSAI 275 chicken
XP_623484    249 MQLRSNATCTQIICIQDGLFNIQQALLSKYWNLKEIMYNM 288 honey bee

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap