Conserved Protein Domain Family
ARD1

?
cd04158: ARD1 
(ADP-ribosylation factor domain protein 1 (ARD1)
ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membrane. Two Tyr-based motifs in the Arf domain are responsible for Golgi localization, while the GAP domain controls lysosomal localization.
Statistics
?
PSSM-Id: 206723
Aligned: 4 rows
Threshold Bit Score: 327.371
Threshold Setting Gi: 47228454
Created: 22-Sep-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on alignment to Arl2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            #######              ##                     #                            
NP_001647 406 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRD 485 human
XP_424752 410 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRD 489 chicken
AAH77512  420 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVIDSSHRE 499 African clawed frog
CAG05274  425 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVIDSCHRD 504 Tetraodon nigrovir...
XP_424752 410 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRD 489 chicken
AAH77512  420 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVIDSSHRE 499 African clawed frog
CAG05274  425 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVIDSCHRD 504 Tetraodon nigrovir...
Feature 1                                ## #                                                 
NP_001647 486 RISEAHSELAKLLTEKELRDALLLIFANKQDVA--------------------------------GALSVEEITELLSLH 533 human
XP_424752 490 RVSEAHSELAKLLTEKELRDALLLIFANKQDVA--------------------------------GALSVEEITELLSLH 537 chicken
AAH77512  500 RVAEAHSELAKLLTEKELRDALLLIFANKQDVT--------------------------------GSLSVEEMTELLSLH 547 African clawed frog
CAG05274  505 RLMEAHSELAKLLTEKELRDALLLIFANKQVLDdlggggrgapisrgpscvnpavpararlqdvpGAVPVEEMTELLSLH 584 Tetraodon nigrovir...
XP_424752 490 RVSEAHSELAKLLTEKELRDALLLIFANKQDVA--------------------------------GALSVEEITELLSLH 537 chicken
AAH77512  500 RVAEAHSELAKLLTEKELRDALLLIFANKQDVT--------------------------------GSLSVEEMTELLSLH 547 African clawed frog
CAG05274  505 RLMEAHSELAKLLTEKELRDALLLIFANKQVLDdlggggrgapisrgpscvnpavpararlqdvpGAVPVEEMTELLSLH 584 Tetraodon nigrovir...
Feature 1                  ###                         
NP_001647 534 KLCCGRSWYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA 574 human
XP_424752 538 KLCCGRNWYIQGCDARSGTGLFEGLDWLSRQLVAAGVLDVA 578 chicken
AAH77512  548 KLCCGRSWYIQGCDARSGMGLYDGLDWLSRQLVAAGVLDVA 588 African clawed frog
CAG05274  585 KLCCGRSWHIQGCDARSGMGLHEGLDWLSRQLVAAGVLDVA 625 Tetraodon nigroviridis
XP_424752 538 KLCCGRNWYIQGCDARSGTGLFEGLDWLSRQLVAAGVLDVA 578 chicken
AAH77512  548 KLCCGRSWYIQGCDARSGMGLYDGLDWLSRQLVAAGVLDVA 588 African clawed frog
CAG05274  585 KLCCGRSWHIQGCDARSGMGLHEGLDWLSRQLVAAGVLDVA 625 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap