Conserved Protein Domain Family
Rit_Rin_Ric

?
cd04141: Rit_Rin_Ric 
Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric)
Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics. These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains. Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42. Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells. Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42. This ternary complex is proposed to have physiological function in processes such as tumorigenesis. Activated Ric is likely to signal in parallel with the Ras pathway or stimulate the Ras pathway at some upstream point, and binding of calmodulin to Ric may negatively regulate Ric activity.
Statistics
?
PSSM-Id: 206712
View PSSM: cd04141
Aligned: 8 rows
Threshold Bit Score: 319.107
Threshold Setting Gi: 21392164
Created: 1-Sep-2005
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity to other members of the Ras family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #######                                      #  #                     
gi 50603602  16 REYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKMRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIIC 95
gi 55663544  37 REYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIIC 116
gi 17390126  19 REYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIIC 98
gi 1702926   19 REYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIIC 98
gi 17390627  19 REYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIIC 98
gi 1702877   58 RVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFTAMRDQYMRCGEGFIIC 137
gi 7302995   58 RVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFTAMRDQYMRCGEGFIIC 137
gi 21392164  58 RVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQRQAVIDNEAALLDILDTAGQVEFTAMRDQYMRCGEGFIIC 137
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                         ## #                          ##              
gi 50603602  96 YSITDRRSFHEARDFKELIYRVRRTDDTPVVLVGNKSDLTRLRQVSKEEGNSLAREFNCPFFETSAAF-RYYIDDVFHAL 174
gi 55663544 117 YSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAY-RYYIDDVFHAL 195
gi 17390126  99 YSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAAL-RFCIDDAFHGL 177
gi 1702926   99 YSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAAL-RFCIDDAFHGL 177
gi 17390627  99 YSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGMNLARDYNCAFFETSAAL-RFGIDDAFQGL 177
gi 1702877  138 YSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTTEEGRNLANQFGCPFFETSAAL-RHYIDEAFYTL 216
gi 7302995  138 YSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTTEEGRNLANQFGCPFFETSAAL-RHYIDEAFYTL 216
gi 21392164 138 YSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTTEEGRNLSTSSAARFLRHRLHCvITSTRHSTRWS 217
                       170
                ....*....|...
Feature 1                    
gi 50603602 175 VREIRRKEKEAAL 187
gi 55663544 196 VREIRRKEKEAVL 208
gi 17390126 178 VREIRKKESMPSL 190
gi 1702926  178 VREIRKKESMPSL 190
gi 17390627 178 VREIRRKESMLSL 190
gi 1702877  217 VREIRRKEMHKAL 229
gi 7302995  217 VREIRRKEMHKAL 229
gi 21392164 218 ARFDARKCTRPWA 230

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap