1M7B


Conserved Protein Domain Family
Rnd

?
cd04131: Rnd 
Click on image for an interactive view with Cn3D
Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8
The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8. These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos. Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated. In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity. They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 206703
Aligned: 7 rows
Threshold Bit Score: 299.734
Threshold Setting Gi: 156387558
Created: 28-Jul-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Structure:1M7B: Human Rnd3/RhoE binds GTP and Mg2+, defined by 3.5A contacts
    View structure with Cn3D
  • Comment:Rho molecules assume an active conformation when bound to GTP and inactive when GTP is hydrolyzed to GDP
  • Comment:Mg2+ ion plays a key role in bringing together the functional regions of the phosphate-binding, switches I and II
  • Citation:PMID 9545299

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  ######                                      ## #                      
1M7B_A         7 KCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICF 86  human
BAB17851      13 RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCF 92  human
AAC37595       7 RCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRPLAYPDSDAVLICF 86  human
XP_001634270  11 NIKVILVGDSECGKTALLNAYVRNQFNEKYEATVFNSLSTAVEVDGERIELTLWDTSGHEDYDHVRPLSYNNVDIVLICF 90  starlet sea ane...
XP_002599495  15 RCKLIVVGDERAGKTALLQVFAKDKFLEEYVPTVFENYKAGFEVEKQRVELSLWDTSGQTAYDNVRPLSYPDSNVILACF 94  Florida lancelet
XP_002738443  13 GCKILLVGDSRCGKSSLLKVFVKESFTEVYVPTIFDNSTASFEVEKYRIDLSLWDTSGCTEYDNVRPLSYTETDCVVVCY 92  Saccoglossus ko...
NP_001002591   8 KCKIVVVGDTQCGKTSLLNVFAKDSFPENYVPTVFENYTASFEVDTLRVELSLWDTSGSPYYDNVRPLSYPDADAVLICF 87  zebrafish
BAB17851      13 RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCF 92  human
AAC37595       7 RCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRPLAYPDSDAVLICF 86  human
XP_001634270  11 NIKVILVGDSECGKTALLNAYVRNQFNEKYEATVFNSLSTAVEVDGERIELTLWDTSGHEDYDHVRPLSYNNVDIVLICF 90  starlet sea ane...
XP_002599495  15 RCKLIVVGDERAGKTALLQVFAKDKFLEEYVPTVFENYKAGFEVEKQRVELSLWDTSGQTAYDNVRPLSYPDSNVILACF 94  Florida lancelet
XP_002738443  13 GCKILLVGDSRCGKSSLLKVFVKESFTEVYVPTIFDNSTASFEVEKYRIDLSLWDTSGCTEYDNVRPLSYTETDCVVVCY 92  Saccoglossus ko...
NP_001002591   8 KCKIVVVGDTQCGKTSLLNVFAKDSFPENYVPTVFENYTASFEVDTLRVELSLWDTSGSPYYDNVRPLSYPDADAVLICF 87  zebrafish
Feature 1                                          # #                                         ##
1M7B_A        87 DIsrPETLDSVLkkWKGEIQEFCP-NTKMLLVGCKSDLRTDVSTLVELSNHRq-tPVSYDQGANMAKQIGAaTYIECSAL 164 human
BAB17851      93 DIsrPETVDSALkkWRTEILDYCP-STRVLLIGCKTDLRTDLSTLMELSHQKq-aPISYEQGCAIAKQLGAeIYLEGSAF 170 human
AAC37595      87 DIsrPETLDSVLkkWQGETQEFCP-NAKVVLVGCKLDMRTDLATLRELSKQRl-iPVTHEQGTVLAKQVGAvSYVECSSR 164 human
XP_001634270  91 DIsrPKTADSILekWIIEVCDLCP-NKPVLLVGCKQDLRSEVNIVSKLASKVcqqPVTSLEGRKLADRICAlDYIECSSK 169 starlet sea ane...
XP_002599495  95 DIgtPESLDGVVkkWHPEVREYCP-SAPILLVGCKADLRQDLKTVTDLAIVGr-sPVSHEQGMTVAKQIGAvAYVECSAK 172 Florida lancelet
XP_002738443  93 DIsvPESLDNVVdkWFPEVRRCGSaGIPIILVGCKMDLRNDIHTITELAQKRq-iTLTHEKGIQVAKQIGAaAFVECSAK 171 Saccoglossus ko...
NP_001002591  88 DIgrPETLENVLrkWKGEIEEFCP-NTKILLVGCKSDLRADLATFVQLSNDI---PSSYDQGSNMAKLISA-PYIECSAQ 162 zebrafish
BAB17851      93 DIsrPETVDSALkkWRTEILDYCP-STRVLLIGCKTDLRTDLSTLMELSHQKq-aPISYEQGCAIAKQLGAeIYLEGSAF 170 human
AAC37595      87 DIsrPETLDSVLkkWQGETQEFCP-NAKVVLVGCKLDMRTDLATLRELSKQRl-iPVTHEQGTVLAKQVGAvSYVECSSR 164 human
XP_001634270  91 DIsrPKTADSILekWIIEVCDLCP-NKPVLLVGCKQDLRSEVNIVSKLASKVcqqPVTSLEGRKLADRICAlDYIECSSK 169 starlet sea ane...
XP_002599495  95 DIgtPESLDGVVkkWHPEVREYCP-SAPILLVGCKADLRQDLKTVTDLAIVGr-sPVSHEQGMTVAKQIGAvAYVECSAK 172 Florida lancelet
XP_002738443  93 DIsvPESLDNVVdkWFPEVRRCGSaGIPIILVGCKMDLRNDIHTITELAQKRq-iTLTHEKGIQVAKQIGAaAFVECSAK 171 Saccoglossus ko...
NP_001002591  88 DIgrPETLENVLrkWKGEIEEFCP-NTKILLVGCKSDLRADLATFVQLSNDI---PSSYDQGSNMAKLISA-PYIECSAQ 162 zebrafish
Feature 1                          
1M7B_A       165 QSenSVRDIFHVATLACV 182 human
BAB17851     171 TSekSIHSIFRTASMLCL 188 human
AAC37595     165 SSerSVRDVFHVATVASL 182 human
XP_001634270 170 TMdfQLEKVFEMTTLAAI 187 starlet sea anemone
XP_002599495 173 TSelSIRDVFEMATLAAL 190 Florida lancelet
XP_002738443 172 NSrsSVNELFEIATLSSL 189 Saccoglossus kowalevskii
NP_001002591 163 QSenSVRDIFHIATLACV 180 zebrafish
BAB17851     171 TSekSIHSIFRTASMLCL 188 human
AAC37595     165 SSerSVRDVFHVATVASL 182 human
XP_001634270 170 TMdfQLEKVFEMTTLAAI 187 starlet sea anemone
XP_002599495 173 TSelSIRDVFEMATLAAL 190 Florida lancelet
XP_002738443 172 NSrsSVNELFEIATLSSL 189 Saccoglossus kowalevskii
NP_001002591 163 QSenSVRDIFHIATLACV 180 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap