Conserved Protein Domain Family
Miro1

?
cd01893: Miro1 
Mitochondrial Rho family 1 (Miro1), N-terminal
Miro1 subfamily. Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the N-terminal GTPase domain of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Statistics
?
PSSM-Id: 206680
View PSSM: cd01893
Aligned: 16 rows
Threshold Bit Score: 249.947
Threshold Setting Gi: 66827967
Created: 6-Jan-2012
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Rho molecules assume an active conformation when bound to GTP and inactive when GTP is hydrolyzed to GDP
  • Comment:Mg2+ ion plays a key role in bringing together the functional regions of the phosphate-binding, switches I and II
  • Citation:PMID 9545299

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  ######                                         ## #                  
gi 25187967   3 RDVRILLLGEAQVGKTSLILSLVGEEFPEE---VPPRAEEITIPa-DVTPEKVPTHIVDYSEAEQTDEELREEiHKANVV 78
gi 15240981  16 KSVRIVVVGDKGTGKSSLIVAAATDSFPPN---VPPVLPDYKLPi-EFFPDGIPVTIVDTSSRPEDRDIVAEElKRADAV 91
gi 17541392   8 ADVRIVLIGDEGCGKTSLVMSLLEDEWVDA---VPRRLDRVLIPa-DVTPENVTTSIVDLSIKEEDENWIVSEiRQANVI 83
gi 18412634  13 TSLRVAVAGDKGTGKSSLISAVASETFPDN---VPRVLPPITLPa-DAFPDYIPITIVDTPSSIDNRIKLIEEfRKADVV 88
gi 24649499  10 KNVRILLVGDAGVGKTSLILSLVSEEYPEE---VPPRAEEITIPa-NVTPEQVPTSIVDFSAVEQSEDALAAEiNKAHVV 85
gi 50540759  14 QGVRVVVIGDPGTGKSSLVVSVATEAFPEN---VPRVMPPTRLPa-DYFPDRVPITIVDTSSSPEHRAKLIAEcQAADAV 89
gi 57227593   5 DLVRIVLVGDDGVGKSSIITSLIKEAFVTN---VPHVVPEVTIPp-EITPENFTTSIVDTSSNPRSRPHLLSSiSRAHVI 80
gi 71015205   3 KDVRIVLAGDPDVGKSTLITSLVKEAYVAK---VQKVVPPITLPp-EVAPEAVVTKIVDTSSSPEHRANLEAElRRANVI 78
gi 2995366    2 KEVRVVICGDQGVGKSSLISALIQEDNVTS---IPKVFPIISIPsnPDSNDDVSLVLVDTQSDSNEREYLAAEiKKANVI 78
gi 50540756  13 LDVRVAVIGDHGTGKSSLVATIATGRFPDQddgVARVLPPARLPv-DYFPARVPVTIVDTSSRYCQTADAVVL-TYACDR 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                  # #                  
gi 25187967  79 CVVYDVSEEATIEKirTKWIPLVNGgttq-------------------gprvPIILVGNKSDLRSGss-----mEAVLPI 134
gi 15240981  92 VLTYACDRPETLERlsEYWLPELRRlev----------------------kiPIIVAGCKLDFRDDnnqv-sleQVMSPI 148
gi 17541392  84 CVVYSVTDESTVDGiqTKWLPLIRQsfge-------------------yhetPVILVGNKSDGTANn------tDKILPI 138
gi 18412634  89 LLTYACDQPSTLDRlsSYWLPELRRlei----------------------kaPVIVVGCKLDLRDErspa-rleDIMSPI 145
gi 24649499  86 CIVYAVDDDDTLDRitSHWLPLVRAkcnpsldgegdaeaeaegdtqrepirkPIVLVGNKIDLIEYst-----mDSVLAI 160
gi 50540759  90 VLTYACDRPATLERlsTFWLPELRRlql----------------------kaPVIVVGCKLDLRDEqqv--sleQVMAPI 145
gi 57227593  81 CLVYSIADPSSFDRvaEYWLPLFRRegi----------------------nvPVILVGNKIDLRGGrvtnqgleDESAPI 138
gi 71015205  79 CIVYSISAPSSFDRipTYWLPYIRSlgv----------------------nvPVILVGNKIDLRSGdvtnaaleDELAPV 136
gi 2995366   79 CLVYSDNYSYERVS--IFWLPYFRSlgv----------------------nvPIVLCENKSEDLDNyqglhtieHEMIPL 134
gi 50540756  91 PNTLERITTFWLPK--IRRLLQSKV---------------------------PVILAGCKVDLSDKqqqa-gleNVLDFI 140
                       170       180       190
                ....*....|....*....|....*....|....*
Feature 1                     ##                   
gi 25187967 135 MSQFSEIETCVECSAKNLRNISELFYYAQKAVLHP 169
gi 15240981 149 MQQFREIETCIECSALKQLQAQEVFYYAQKTVLHP 183
gi 17541392 139 MEANTEVETCVECSARTMKNVSEIFYYAQKAVIYP 173
gi 18412634 146 MKEYREIETCIECSALTLIQVPDVFYFASKAVLHP 180
gi 24649499 161 MEDYPEIESCVECSAKSLHNISEMFYYAQKAVLHP 195
gi 50540759 146 MQTFREIETCIECSALRQIQVPEVFYYAQKAVLHP 180
gi 57227593 139 MREFKEVETVVECSALLPLNVSEVFYFAQKAVLHP 173
gi 71015205 137 MAEFKEVETCVECSARIPLNVSEVFYFAQKAVLYP 171
gi 2995366  135 INEFKEIEACILCSALEKINVNELFYMCRACVIYP 169
gi 50540756 141 MCTFREVEIYLECSALHRIKVDEVFYCAQMAVLRP 175

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap