1K5D,1BYU,1I2M,1A2K,1QBK,2BKU,1WA5,2X19,3GJX


Conserved Protein Domain Family
Ran

?
cd00877: Ran 
Click on image for an interactive view with Cn3D
Ras-related nuclear proteins (Ran)/TC4 family of small GTPases
Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division. Among the Ras superfamily, Ran is a unique small G protein. It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily. Ran may therefore interact with a wide range of proteins in various intracellular locations. Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors. Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins. The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is bound to chromatin and confined to the nucleus. Ran itself is mobile and is actively imported into the nucleus by a mechanism involving NTF-2. Together with the compartmentalization of its regulators, this is thought to produce a relatively high concentration of RanGTP in the nucleus.
Statistics
?
PSSM-Id: 206643
Aligned: 36 rows
Threshold Bit Score: 239.511
Threshold Setting Gi: 47027100
Created: 4-Feb-2003
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Structure:1K5D: Human Ran binds GppNHp, a GTP analog and Mg2+, defined using 3.5 A contacts
    View structure with Cn3D
  • Citation:PMID 7744835
  • Structure:1BYU: Canis lupus familiaris Ran bind GDP and Mg2+, defined using 3.5 A contacts
    View structure with Cn3D
  • Citation:PMID 9878368

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              # ####                                                                 
1K5D_A     11 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIM 89  human
BAA81911   14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTT-NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIM 92  Japanese rice
BAB08588   14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFT-NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIM 92  thale cress
AAF49642   11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNT-NRGVFRIDVWDTAGQERYGGLRDGYFVQSQCAIIM 89  fruit fly
CAD25345    8 YKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDdQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAIFF 87  Encephalitozoon cu...
AAT12341    9 FKVVLVGDGGTGKTTYIHRILEGVFIKDYVATCGARVYQINFNTnYGFQLEFDVWDTAGQELKSMLSDAYYINSDAAMIF 88  Antonospora locustae
BAB08577   14 FKLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFT-NRGKIRFECWDTAGQEKYSGLKDAYYIHGQCAIIM 92  thale cress
XP_644189 513 IKLVLIGDGGVGKSTYINRLLTGEFETQYVATFGCSVHKFNFKT-TIGDVNFSIWDMAFTRLPGAMRDDYMTGAECAIIM 591 Dictyostelium disc...
ABA27345    9 FKLILVGDGGSGKTTFVKRHKTGEYTLKYKPTVGCAVYFLDFTT-NKGKVVFGCWDTAGQEKFGGLRDGYYVGSDCAIVM 87  Bigelowiella natans
AAT08763   21 SSSSSSATAEPEKLHSRKGIPTGEFEKKYEPTIGVEVHPLDFFT-NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIM 99  common hyacinth
BAA81911   14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTT-NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIM 92  Japanese rice
BAB08588   14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFT-NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIM 92  thale cress
AAF49642   11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNT-NRGVFRIDVWDTAGQERYGGLRDGYFVQSQCAIIM 89  fruit fly
CAD25345    8 YKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDdQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAIFF 87  Encephalitozoon cu...
AAT12341    9 FKVVLVGDGGTGKTTYIHRILEGVFIKDYVATCGARVYQINFNTnYGFQLEFDVWDTAGQELKSMLSDAYYINSDAAMIF 88  Antonospora locustae
BAB08577   14 FKLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFT-NRGKIRFECWDTAGQEKYSGLKDAYYIHGQCAIIM 92  thale cress
XP_644189 513 IKLVLIGDGGVGKSTYINRLLTGEFETQYVATFGCSVHKFNFKT-TIGDVNFSIWDMAFTRLPGAMRDDYMTGAECAIIM 591 Dictyostelium disc...
ABA27345    9 FKLILVGDGGSGKTTFVKRHKTGEYTLKYKPTVGCAVYFLDFTT-NKGKVVFGCWDTAGQEKFGGLRDGYYVGSDCAIVM 87  Bigelowiella natans
AAT08763   21 SSSSSSATAEPEKLHSRKGIPTGEFEKKYEPTIGVEVHPLDFFT-NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIM 99  common hyacinth
Feature 1                                         #  #                           ##           
1K5D_A     90 FDVT-SRVTYKNVPNWHRDLVRVCe---NIPIVLCGNKVDIk--DRKVKAKSIVFHRKKNlQYYDISAKSNYNFEKPFLW 163 human
BAA81911   93 FDVT-SRLTYKNVPTWHRDLCRVCe---NIPIVLCGNKVDVk--NRQVKAKQVTFHRKKNlQYYEISAKSNYNFEKPFLY 166 Japanese rice
BAB08588   93 FDVT-ARLTYKNVPTWHRDLCRVCe---NIPIVLCGNKVDVk--NRQVKAKQVTFHRKKNlQYYEISAKSNYNFEKPFLY 166 thale cress
AAF49642   90 FDVA-SSNTYNNVKRWHRDLVRVCg---NIPIVICGNKVDIm--HKKTWKKGVDFDRKTNiYLIEMSAKSNYNVEKPFVY 163 fruit fly
CAD25345   88 FDVT-SRITCQNLARWVKEFQAVVg--nEAPIVVCANKIDIknrQKISKKLVMEVLKGKNyEYFEISAKTAHNFGLPFLH 164 Encephalitozoon cu...
AAT12341   89 FDVT-SKVTFVNVPNWLRRIQAVCcgdkHIPIVLCGNKVDCs-nRKVKEQFIARSLKSGItMYVEISAKTNYNFELPFLA 166 Antonospora locustae
BAB08577   93 FDVT-ARHTYMNIDRWYRDLRRVCk---NIPIVLCGNKVDVp--SRQIKPKHVSYHRKKClQYYEMSAKNNCNFEKPFLY 166 thale cress
XP_644189 592 FDVC-SRESYRSVNDWFNELLRITg--kVVPMVLVGNKVESm--GKRINPSQIIFHRKKNiSYFELSVRTNFNLEKPFLK 666 Dictyostelium disc...
ABA27345   88 FDLS-FRSTYKNIPVWYRDVSRICf---NIPIAIVGNKYDLl-dKKDEEERVMQFRRKYGsQYMEISARKNYNYEKPFLY 162 Bigelowiella natans
AAT08763  100 FDVTaRRLTRMSQPGTVTFAGCVR----TFPQSSVVTRLMRr--IDRRRPSKRRSIGRRTcSIIEISAKSNYNFEQAVPV 173 common hyacinth
BAA81911   93 FDVT-SRLTYKNVPTWHRDLCRVCe---NIPIVLCGNKVDVk--NRQVKAKQVTFHRKKNlQYYEISAKSNYNFEKPFLY 166 Japanese rice
BAB08588   93 FDVT-ARLTYKNVPTWHRDLCRVCe---NIPIVLCGNKVDVk--NRQVKAKQVTFHRKKNlQYYEISAKSNYNFEKPFLY 166 thale cress
AAF49642   90 FDVA-SSNTYNNVKRWHRDLVRVCg---NIPIVICGNKVDIm--HKKTWKKGVDFDRKTNiYLIEMSAKSNYNVEKPFVY 163 fruit fly
CAD25345   88 FDVT-SRITCQNLARWVKEFQAVVg--nEAPIVVCANKIDIknrQKISKKLVMEVLKGKNyEYFEISAKTAHNFGLPFLH 164 Encephalitozoon cu...
AAT12341   89 FDVT-SKVTFVNVPNWLRRIQAVCcgdkHIPIVLCGNKVDCs-nRKVKEQFIARSLKSGItMYVEISAKTNYNFELPFLA 166 Antonospora locustae
BAB08577   93 FDVT-ARHTYMNIDRWYRDLRRVCk---NIPIVLCGNKVDVp--SRQIKPKHVSYHRKKClQYYEMSAKNNCNFEKPFLY 166 thale cress
XP_644189 592 FDVC-SRESYRSVNDWFNELLRITg--kVVPMVLVGNKVESm--GKRINPSQIIFHRKKNiSYFELSVRTNFNLEKPFLK 666 Dictyostelium disc...
ABA27345   88 FDLS-FRSTYKNIPVWYRDVSRICf---NIPIAIVGNKYDLl-dKKDEEERVMQFRRKYGsQYMEISARKNYNYEKPFLY 162 Bigelowiella natans
AAT08763  100 FDVTaRRLTRMSQPGTVTFAGCVR----TFPQSSVVTRLMRr--IDRRRPSKRRSIGRRTcSIIEISAKSNYNFEQAVPV 173 common hyacinth
Feature 1                  
1K5D_A    164 LARKLIGDPNLEF 176 human
BAA81911  167 LARKLAGDPNLHF 179 Japanese rice
BAB08588  167 LARKLAGDANLHF 179 thale cress
AAF49642  164 LLRKLVGDPSLQL 176 fruit fly
CAD25345  165 LARIFTGRPDLIF 177 Encephalitozoon cuniculi GB-M1
AAT12341  167 LARKLTGIDNLTF 179 Antonospora locustae
BAB08577  167 LARRIAGDAKLSF 179 thale cress
XP_644189 667 LIRLLSGNDNVDL 679 Dictyostelium discoideum AX4
ABA27345  163 LMRRLLKNNDVDF 175 Bigelowiella natans
AAT08763  174 FGKKNCWGILTST 186 common hyacinth
BAA81911  167 LARKLAGDPNLHF 179 Japanese rice
BAB08588  167 LARKLAGDANLHF 179 thale cress
AAF49642  164 LLRKLVGDPSLQL 176 fruit fly
CAD25345  165 LARIFTGRPDLIF 177 Encephalitozoon cuniculi GB-M1
AAT12341  167 LARKLTGIDNLTF 179 Antonospora locustae
BAB08577  167 LARRIAGDAKLSF 179 thale cress
XP_644189 667 LIRLLSGNDNVDL 679 Dictyostelium discoideum AX4
ABA27345  163 LMRRLLKNNDVDF 175 Bigelowiella natans
AAT08763  174 FGKKNCWGILTST 186 common hyacinth

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap