3T6G


Conserved Protein Domain Family
DUF3513

?
pfam12026: DUF3513 (this model, PSSM-Id:204811 is obsolete and has been replaced by 338219)
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3513)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 192 to 218 amino acids in length. This domain is found associated with pfam00018, pfam08824. This domain has a conserved QPP sequence motif.
Statistics
?
PSSM-Id: 204811
View PSSM: pfam12026
Aligned: 15 rows
Threshold Bit Score: 225.789
Threshold Setting Gi: 341940476
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3T6G_B         5 SPDGq-YENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITrqgks-------------------------------- 51
gi 74866499  341 GTGVleGSRGSAEWLEDYDYVAFESKDAAARKNEALREAIPAD------------------------------------- 383
gi 82197298  457 PSDDihSEYERIQ-CRDNHYVHLQGSITAQN------------------------------------------------- 486
gi 341940476 363 DPAGphNEYEGIPMAEEYDYVHLKGVDTAQGSRP--LDKA---------------------------------------- 400
gi 82203101  639 NARQrkHPLPRQKTIEDSDYVHLQKKEEFERA-KSIFSHQQLEnttkt-------------------------------- 685
gi 123778185 612 SYQEssPFDRQPTTEHSFELARKNRVNVCWQQSPNLQEKGKPT------------------------------------- 654
gi 206558170 593 EPVQ---------WTPNAEFKLARRIQLPQKEGESYQRKAPFQkq----------------------------------- 628
gi 123913931 549 KANMn-SEKCVKSWMDDYDYVHLQGKDEFERQQKKLLEKENITkqgkv-------------------------------- 595
gi 82251077  230 SPDKd-SEKCVKSWMEDYDYVHLQGKDDFERQQKELLDKENIMkqsqsqlgqeqvsahththartrtharthththtqlt 308
gi 149642919 364 HPAGhhNEYEGIPVAEEYDYVHLKGMDKVQEARPPDKA------------------------------------------ 401
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3T6G_B        52 -qlelqQLKQFERLEQEVSRPIDHD--LA---------NWTPAQPLAPGR----TGgLGPSDRQLLLFYLEQCEANLTTL 115
gi 74866499  384 ------LKTQFDTVIRTAESSAMGA--GSgs------iPTTPTARTTPTTpcksPE-MTDKDKKLVRYYAQQISTHMGNL 448
gi 82197298  487 ------ISKRKDRQKDTGQGSTLEE---------------REVDPFPE---------ASEEDRHLLHFYATQSHSHLQTL 536
gi 341940476 401 ------FPVDPELLERGLAERKEAL---------------SPEEPLV----------LSTGDLQLLHFYAGQCQSHYSAL 449
gi 82203101  686 -eekrkGWIKPERLISGSEKQEKKDklLTt---------kEPSTLTPKq----dTS-HSPESPKKFNLSEHSC-LYFGAL 749
gi 123778185 655 ---------------MEGKSNRNPD--FHg---------mSPPPLTSP-------S-PSGQNTERKIHLSKHSRLYFGAL 700
gi 206558170 629 ----raSEQPPELIEKNKTNACGQN----------------PGSLIPR-------P-LSQQNPEKRIHLSEHCRLYFGAL 680
gi 123913931 596 -qlgqdQLNQFKQLEQDVIKPVEND--ITkwishqnstGSSSSDSSSNFSmgggAP-LCSRDRQLLGFYADQCEQHFVTL 671
gi 82251077  309 errcppQIKQFRKLEQEVIKPVEND--ITqwvs--lqrASSPADSSSSSSsstsAS-VCARDRQLLAFYSEQCQQHFVTL 383
gi 149642919 402 ------SPGDPEQLEREPPEQQEAL---------------SPGESLV----------LPTGDLQLLHFYAGQCQGHYSTL 450
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3T6G_B       116 TNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYP 195
gi 74866499  449 MQAIDSFLETVEKNQPPKFFIAYGKFVVVSAHNLVTIGDNVYRNISKEALREKILRCTNALSDALKTCVLKSKKAAAHFP 528
gi 82197298  537 LSCVGTFLGS-ASSQPPRVFVGHGKQLVIAAHKLVFIGDTLGRLLSCPQLQTRLAGEGAALCQALKDVVLATKEAATLYP 615
gi 341940476 450 QAAVAALVASTQANQPPCLFVPHGKRVVVAAHRLVFVGDTLGRLAASAALRAQVGAAGTMLAQTLRATVLAVKGAALGYP 529
gi 82203101  750 QKAIGVFNNSLNNNQPPEIFITHGKLIIMVGQKLV---DSVCQDVKTSEVRNDVLFKSSELCGLLNNLALATKTAAIQYP 826
gi 123778185 701 FKAISVFASSLSNGQPPEVFITQSKLVITVGQKLV---DTLCSETQEKDERNEILCGSSHLCGLLKDLALATKSAVIQYP 777
gi 206558170 681 LKAIGVLNGSLSNRQPPETFITQSKLIIMVGQKLV---DTLCKETQERDFRNEILCGSSHLCSLLRNLALATKHAVLEYP 757
gi 123913931 672 LNAVDAFFGCVKSGQPPRIFVAHGKFVILSAHKLVFIGDTLSRQATVAEVANRVMNLSNMLCEMLKTVVSSTKIAALHYP 751
gi 82251077  384 LSAVDAFFGCVGAGQPPRIFVAHSKFVILSAHKLVFIGDTLSRQAAAPEVANRVMNCSNVLCDLLKTVVAATKTAALNYP 463
gi 149642919 451 QAAVAALMSSTQAKQPPHLFVPHGKRALVAAHRLVFVGDTLGRLAASAPLRAQVGAAGTALGQALRATVLAIKGAALGYP 530
                        250       260
                 ....*....|....*....|....*..
3T6G_B       196 SPSAAQDMVERVKELGHSTQQFRRVLG 222
gi 74866499  529 SGSAVQEMVDSVVHINNLARDLKSVML 555
gi 82197298  616 APAALKAMAGTVSVLCTCAHSFTHLLQ 642
gi 341940476 530 SDTAVQEMARCVAELAGQALRFTTLLD 556
gi 82203101  827 NPAALRDMEMRMDQLLKHTQIFRAMAE 853
gi 123778185 778 SPSALSLLQSEVERLEHHSRKFRDTLE 804
gi 206558170 758 SPAALGHLQAEARKLEQHTQQFRGTLE 784
gi 123913931 752 NTAAVQEMVDRVTDLSHLAQQFKVQLS 778
gi 82251077  464 NTAAVQEMVDRVTELSHHAQHFKEQLL 490
gi 149642919 531 SSPAAEEMAQCVADLAGQALQFTTLLT 557
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap