2NYL,2NYL,2NYL,2NYL,2NYL,2NYL,2NYL,3ND2,2QK1


Conserved Protein Domain Family
HEAT

?
pfam02985: HEAT (this model, PSSM-Id:202500 is obsolete and has been replaced by 397231)
Click on image for an interactive view with Cn3D
HEAT repeat
The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514).
Statistics
?
PSSM-Id: 202500
Aligned: 600 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NYL_A   82 LLPPLESLATVE-ETVVRDKAVESLRAISHEH 112  human
Q95JL4  271 IVLQTRTFFEDE-QDDVRLTAIFLFEDLASLT 301  crab-eating macaque
Q7RMJ1  708 LINTLCELVSDT-NAKVKEICIKIFNKLEKNI 738  Plasmodium yoelii yoelii
Q7RN80  163 FINLFLDLCQDQ-SILVKKSCCDKFCKFLEIL 193  Plasmodium yoelii yoelii
Q8IEB9  163 FIYLFLEACQDE-SILVKKSSCDKFGEFIFIL 193  Plasmodium falciparum 3D7
Q7ZUL5  195 FLPRFCEMCCDCrMFHVRKVCAANFGDICSVV 226  zebrafish
Q7ZUL5  235 LLPRFFQLCSDN-VWGVRKACAECFMSVSSAS 265  zebrafish
Q96LY6   60 LIPKFFELCSDA-VWGMRKACAECFTAVSHSS 90   human
Q8C0Y0  399 LYSTFFCLCHDP-EVPVRHTIAICFYEVSKLL 429  house mouse
O59817   94 VVNMLLVASSSK-NLEVLSACVDCFATFCDNS 124  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap