Conserved Protein Domain Family
Phosducin

?
pfam02114: Phosducin (this model, PSSM-Id:202114 is obsolete and has been replaced by 251094)
Click on image for an interactive view with Cn3D
Phosducin
Statistics
?
PSSM-Id: 202114
View PSSM: pfam02114
Aligned: 3 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam02114 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A0R_P       1 MEKAKSQS---LEEDFEGQASHTGPKGVINDWRKFK-LESEDSDSVAHSKKEILRQMSS---------PQSRDDKDSKER 67
gi 130133    1 MEKAKSQS---LEEDFEGQASHTGPKGVINDWRKFK-LESEDSDSVAHSKKEILRQMSS---------PQSRDDKDSKER 67
gi 6174905  35 GAPASSSTpaeAELAGEGISVNTGPKGVINDWRRFKqLETEQREEQCREMERLIKKLSMscrshldeeEEQQKQKDLQEK 114
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A0R_P      68 FSRKMSVQEYELIHKDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELESGEQFLETIEKEQKITTIVVHIYEDGIKG 147
gi 130133   68 FSRKMSVQEYELIHKDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELESGEQFLETIEKEQKITTIVVHIYEDGIKG 147
gi 6174905 115 ISGKMTLKECGMMDKNLDDEEFLQQYRKQRMDEMRQQLHKGPQFKQVLEIPSGEGFLDMIDKEQKSTLIMVHIYEDGVPG 194
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A0R_P     148 CDALNSSLICLAAEYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELLSNFISVTEQLAEEFFTGDVESFLNEYGLL 227
gi 130133  148 CDALNSSLICLAAEYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELLSNFISVTEQLAEEFFTGDVESFLNEYGLL 227
gi 6174905 195 TEAMNGCMICLAAEYPTVKFCRVRSSVIGASSRFTRNALPALLIYKAGELIGNFVRVTDQLGEDFFAVDLEAFLQEFGLL 274
                      250       260
               ....*....|....*....|....*
1A0R_P     228 PEKEMHVLEQTNM-------EEDME 245
gi 130133  228 PEKEMHVLEQTNM-------EEDME 245
gi 6174905 275 PEKEVLVLTSVRNsatchseDSDLE 299
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap