3NRT,3RQR


Conserved Protein Domain Family
RyR

?
pfam02026: RyR (this model, PSSM-Id:202095 is obsolete and has been replaced by 334793)
Click on image for an interactive view with Cn3D
RyR domain
This domain is called RyR for Ryanodine receptor. The domain is found in four copies in the ryanodine receptor. The function of this domain is unknown.
Statistics
?
PSSM-Id: 202095
View PSSM: pfam02026
Aligned: 39 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3NRT_E         10 DYIPEPXDLSLVDLPESLIQLSERIAENVHEVWAKARIDEGWTYGEKRDDIHKKHPCLVPYDELPEEEKEYDRNTAXNTI 89
gi 75073668   848 SFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETL 927
gi 81873542   854 AFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETL 933
gi 74819868   857 AFIPAPVDTANVNLPGYIEMLRDKLAENIHELWCMNKIEAGWTWGPVRDDSKKVHDSLMFFSSLSEQEKNFDITMAYETL 936
gi 82254835   851 VFIPAPVDISKVSLPPQLEDIQEKLAENIHELWAMDKIDLGWTYGPVRDEAKKNDPSLAEFSKLSEHERNQNLHVAQDTL 930
gi 74765266   852 PFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTM 931
gi 82254835   965 GYRPAPVDLSQVLLSSEHQEVVNLLAENDHNVWARERIAQGWTYGTQQDVKAKRSPYLVPYSFLDEKTRRLSRDSVREVV 1044
gi 75069521   975 GYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAV 1054
gi 296214287  931 GYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAV 1010
gi 156523287  850 sFTPCPVDTAQIVLPPHLERIREKLAENIHELWAVTRIEQGWTYGVFRDDNKKLHPCLVDFQSLPEPERNYNLQMSGETL 929
                          90
                  ....*....|....*.
3NRT_E         90 KXVKKLGFRIEK---E 102
gi 75073668   928 KTLLALGCHIAHv-nP 942
gi 81873542   934 KTLLALGCHVGIa-dE 948
gi 74819868   937 RTLMALGYHISId-eE 951
gi 82254835   931 RTLLAFGFCIGFn-eG 945
gi 74765266   932 KTIEALGYHLITe-dP 946
gi 82254835  1045 GTLLAFGYSLDPhslK 1060
gi 75069521  1055 RTLLGYGYNLEAp-dQ 1069
gi 296214287 1011 RTFVGYGYNIEPs-dQ 1025
gi 156523287  930 KTLLALGCHVGMg-dE 944
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap