Conserved Protein Domain Family
Filament

?
pfam00038: Filament (this model, PSSM-Id:200948 is obsolete and has been replaced by 306535)
Intermediate filament protein
Statistics
?
PSSM-Id: 200948
View PSSM: pfam00038
Aligned: 33 rows
Threshold Bit Score: 257.897
Threshold Setting Gi: 124233
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00038 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125959      29 QEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEEREEVSSREVTNLRQLYETELADARKLLDQTANERARLQVELGKV 108
gi 400800      76 NEKRELQELNDRFASFIEKVRHLEQQNSKLILELGQYKDQHQGSTGRINELCQQEMRELRRQLELMAKDRDQMQVERDNL 155
gi 129822      93 NEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQ---EPARADQLCQQELRELRRELELLGRERDRVQVERDGL 169
gi 121135      68 SERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAK---EPTKLADVYQAELRELRLRLDQLTANSARLEVERDNL 144
gi 118453      98 NEKVELQELNDRFANYIEKVRFLEQQNALMVAEVNRLRGK---QPTRVAEMYEEELRELRRQVDALTGQRARVEVERDNL 174
gi 124212      96 NEKAEMIELNDRLANFLDKVRSLEQQNKMLLAELEQVKGK---RPSKIGDLYEQELRELRLQIDQISNEKSRVEVERDNL 172
gi 138531      95 NEKAEMIELNDRFANFIDKVRFLEQQNKILVAELEQLKGK---GTSRIGDLYEEEMRELRRQLDQATNDKARVEVDRDNL 171
gi 226726294   96 SEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQ-QAGRSAMGELYEREVREMRGAVLRLGAARGQLRLEQEHL 174
gi 128146      95 NEKEQLQGLNDRFAGYIEKVHYLEQQNKEIEAELAALRQK-HAGRAQLGDAYEQELRELRGALEQVSHEKAQIQLDSEHI 173
gi 1703221     93 NEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQR-HAEPSRVGELFQRELRELRAQLEEASSARAQALLERDGL 171
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125959     109 REEYRQLQARNSKKendlslaqnqlrdlesklntkeaelataLSGKRGLEEQLQEQRaqiaglesslrdttKQLHDEMLW 188
gi 400800     156 AEDVALLNQRLNEE----------------------------MGKRQEAENNLTLFR--------------KDVDDATLA 193
gi 129822     170 AEDLGALKQRLEEE----------------------------TRKREDAEHNLVLFR--------------KDVDDATLS 207
gi 121135     145 AQDLATVRQKLQDE----------------------------TNLRLEAENNLAAYR--------------QEADEATLA 182
gi 118453     175 LDNLQKLKQKLQEE----------------------------IQLKQEAENNLAAFR--------------ADVDAATLA 212
gi 124212     173 ADDLQKLREKLQDE----------------------------VIQREDAENNLAAFR--------------QDVDDACLA 210
gi 138531     172 ADDLQRLREKLQDE----------------------------MIQKEEAEGNLQSFR--------------QDVDNASLA 209
gi 226726294  175 LEDIAHVRQRLDDE----------------------------ARQREEAEAAARALA--------------RFAQEAEAA 212
gi 128146     174 EEDIQRLRERFEDE----------------------------ARLRDETEATIAALR--------------KEMEEASLM 211
gi 1703221    172 AEEVQRLRARCEEE----------------------------SRGREGAERALKAQQ--------------RDVDGATLA 209
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125959     189 RVDLENKMQTIREQLDFQKNIHTQEVKEIKKRH-------DTRIVEIDS-GRRVEfeskLAEALQELRRDHEQQILEYKE 260
gi 400800     194 RLELERKIESLMDEIEFLKKMHDEEIQDVQVSVq-----sQQMKMEVMEtSSRPD----LTGALRDIRAQYESIATKNMQ 264
gi 129822     208 RLELERKIESLMDEIEFLKKLHEEELRDLQVSVes----qQVQQVEVEA-TVKPE----LTAALRDIRAQYENIAAKNLQ 278
gi 121135     183 RLDLERKIESLEEEIRFLRKIHEEEVRELQEQLa-----rQQVHVELD--VAKPD----LTAALKEIRTQYEAMASSNMH 251
gi 118453     213 RIDLERRIESLQEEIAFLKKVHEEEIRELQAQLq-----eQHIQVEMD--ISKPD----LTAALRDIRAQYESIAAKNIA 281
gi 124212     211 RLDLERKVETLQEEIMFLKKLHEEEIIELQAQIr-----dSQFKVEMD--VVRPD----LTAALQDVRSQFDKLASKNIA 279
gi 138531     210 RIDLERKVESLQEEIAFLKKLHDEEIRELQLQIq-----eSHIQVDMD--VSKPD----LTAALRDVRQQYENVAAKNLS 278
gi 226726294  213 RVDLQKKAQALQEECGYLRRHHQEEVGELLGQIqgsgaaqAQMQAETRD-ALKCD----VTSALREIRAQLEGHAVQSTL 287
gi 128146     212 RAELDKKVQSLQDEVAFLRGNHEEEVAELLAQLq-----aSHATVERKD-YLKTD----LTTALKEIRAQLECQSDHNMH 281
gi 1703221    210 RLDLEKKVESLLDELAFVRQVHDEEVAELLATLqa----sSQAAAEVDVaVAKPD----LTSALREIRAQYESLAAKNLQ 281
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125959     261 HLEKNFSAKLENAQLAAAKNSDYASATREEIMATKLRVDTLSSQLNHYQKQNSALEAKVRDLQDMLDRAHDMHRRQMTEK 340
gi 400800     265 ESEEWYKSKFADLTDSAKRNAEAMRQGKQENNDLRRQIQAQNCDIDSLKRTNEALLRQMREMEEQFAAEARNYQDTVSRL 344
gi 129822     279 EAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAARL 358
gi 121135     252 EAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARL 331
gi 118453     282 EAEEWYKSKVSDLTQAANKNNDALRQAKQEMLEYRHQIQSYTCEIDALKGTNDSLMRQMREMEERFAGEAGGYQDTIARL 361
gi 124212     280 ETEELYKSKLADITDSASRNNDALRLAKQENNEYRRQVQSLTCEIDALKGTNESLERQMQDVEDRYNMETTNAQDTISHL 359
gi 138531     279 DAEEWYKSKFADLSEAANRNNDALRQAKQETSDFRRQIQTLTCEIDAMKGSNESYERQMREMEENFAIEAANYQDTIQRL 358
gi 226726294  288 QSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEAIQQL 367
gi 128146     282 QAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEERHNNDLTTYQDTIHQL 361
gi 1703221    282 SAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQL 361
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*
gi 125959     341 DREVTEIRQTLQGQLEEYEQLLDVKLALDMEINAYRKMLEGEEQR 385
gi 400800     345 EDEIRNLKEEMSRHLREYQDLLNVKMALDIEIATYRKLLEGEENR 389
gi 129822     359 EEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESR 403
gi 121135     332 EEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENR 376
gi 118453     362 EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEENR 406
gi 124212     360 EDEISHLKDEMTRHLQEYQELLTVKMALDVEIATYRKLLEGEENR 404
gi 138531     359 QEEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESR 403
gi 226726294  368 DAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECR 412
gi 128146     362 ENELRGTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR 406
gi 1703221    362 ESDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR 406
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap