1M2O,1MOZ,1UPT,2KSQ


Conserved Protein Domain Family
Arf

?
pfam00025: Arf (this model, PSSM-Id:200938 is obsolete and has been replaced by 394982)
Click on image for an interactive view with Cn3D
ADP-ribosylation factor family
Pfam combines a number of different Prosite families together
Statistics
?
PSSM-Id: 200938
Aligned: 20 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M2O_B  10 FRDVLASLGLw-NKHGKLLFLGLDNAGKTTLLHMLKNDRLAT---LQPTWHPTSEELAI-----GNIKFTTFDLGGHIQA 80  baker's yeast
P40617   8 QTSILSNLPS--FQSFHIVILGLDCAGKTTVLYRLQFNEFVN---TVPTKGFNTEKIKVtlgnsKTVTFHFWDVGGQEKL 82  human
Q01475   7 FYDALAMLGLv-NKHAKMLFLGLDNAGKTTLLHMLKNDRLAV---MQPTLHPTSEELAI-----GNVRFTTFDLGGHQQA 77  Schizosaccharomyces p...
P36536  12 FSSVLQFLGLy-KKSGKLVFLGLDNAGKTTLLQMLKDDRLGQ---HVPTLHPTSEELTI-----AGMTFTTFDLGGHEQA 82  house mouse
P39110   3 LLSIIRKQKLr-DKEIRCLILGLDNSGKSTIVNKLLPKDEQNndgIMPTVGFQIHSLMI-----KDVTISLWDIGGQRTL 76  Saccharomyces cerevis...
P36405   3 LLSILRKLKSapDQEVRILLLGLDNAGKTTLLKQLASEDISH---ITPTQGFNIKSVQS-----QGFKLNVWDIGGQRKI 74  human
P36404   3 LLTILKKMKQk-ERELRLLMLGLDNAGKTTILKKFNGEDIDT---ISPTLGFNIKTLEH-----RGFKLNIWDVGGQKSL 73  human
Q06849   3 FLTVLKKMRQk-EREMRILLLGLDNAGKTTILKRFNGEPIDT---ISPTLGFNIKTLEH-----NGYTLNMWDVGGQKSL 73  fruit fly
1MOZ_A   5 FSSMFDKLWGs-NKELRILILGLDGAGKTTILYRLQIGEVVT---TKPTIGFNVETLSY-----KNLKLNVWDLGGQTSI 75  baker's yeast
1UPT_A   1 --------gshxTREXRILILGLDGAGKTTILYRLQVGEVVT---TIPTIGFNVETVTY-----KNLKFQVWDLGGLTSI 64  human
P40617   8 QTSILSNLPS--FQSFHIVILGLDCAGKTTVLYRLQFNEFVN---TVPTKGFNTEKIKVtlgnsKTVTFHFWDVGGQEKL 82  human
Q01475   7 FYDALAMLGLv-NKHAKMLFLGLDNAGKTTLLHMLKNDRLAV---MQPTLHPTSEELAI-----GNVRFTTFDLGGHQQA 77  Schizosaccharomyces p...
P36536  12 FSSVLQFLGLy-KKSGKLVFLGLDNAGKTTLLQMLKDDRLGQ---HVPTLHPTSEELTI-----AGMTFTTFDLGGHEQA 82  house mouse
P39110   3 LLSIIRKQKLr-DKEIRCLILGLDNSGKSTIVNKLLPKDEQNndgIMPTVGFQIHSLMI-----KDVTISLWDIGGQRTL 76  Saccharomyces cerevis...
P36405   3 LLSILRKLKSapDQEVRILLLGLDNAGKTTLLKQLASEDISH---ITPTQGFNIKSVQS-----QGFKLNVWDIGGQRKI 74  human
P36404   3 LLTILKKMKQk-ERELRLLMLGLDNAGKTTILKKFNGEDIDT---ISPTLGFNIKTLEH-----RGFKLNIWDVGGQKSL 73  human
Q06849   3 FLTVLKKMRQk-EREMRILLLGLDNAGKTTILKRFNGEPIDT---ISPTLGFNIKTLEH-----NGYTLNMWDVGGQKSL 73  fruit fly
1MOZ_A   5 FSSMFDKLWGs-NKELRILILGLDGAGKTTILYRLQIGEVVT---TKPTIGFNVETLSY-----KNLKLNVWDLGGQTSI 75  baker's yeast
1UPT_A   1 --------gshxTREXRILILGLDGAGKTTILYRLQVGEVVT---TIPTIGFNVETVTY-----KNLKFQVWDLGGLTSI 64  human
1M2O_B  81 RRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELK---DVPFVILGNKIDAPNAVSEAELRSALGLLNttg- 156 baker's yeast
P40617  83 RPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQ---GVPVLIVANKQDLRNSLSLSEIEKLLAMGE---- 155 human
Q01475  78 RRLWRDYFPEVNGIVYLVDCCDFERLSESKAELDALLAMEELA---RVPFLILGNKIDAPGAISEDELKAALGLYQttg- 153 Schizosaccharomyces p...
P36536  83 RRVWKNYLPAINGIVFLVDCADHSRLMESKVELNALMTDETIS---NVPILILGNKIDRTDAISEEKLREIKGLYGqttg 159 house mouse
P39110  77 RPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRigyECAVIVVLNKIDLVEDKSELHRRCLLVESE---- 152 Saccharomyces cerevis...
P36405  75 RPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLS---CVPVLIFANKQDLLTAAPASEIAEGLNLHT---- 147 human
P36404  74 RSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLA---GATLLIFANKQDLPGALSSNAIREVLELDS---- 146 human
Q06849  74 RSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLA---GATLLVLCNKQDLPGALSSNEIKEILHLED---- 146 fruit fly
1MOZ_A  76 RPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQ---DAALLVFANKQDQPGALSASEVSKELNLVE---- 148 baker's yeast
1UPT_A  65 RPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAXLEEEELR---KAILVVFANKQDXEQAXTSSEXANSLGLPA---- 137 human
P40617  83 RPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQ---GVPVLIVANKQDLRNSLSLSEIEKLLAMGE---- 155 human
Q01475  78 RRLWRDYFPEVNGIVYLVDCCDFERLSESKAELDALLAMEELA---RVPFLILGNKIDAPGAISEDELKAALGLYQttg- 153 Schizosaccharomyces p...
P36536  83 RRVWKNYLPAINGIVFLVDCADHSRLMESKVELNALMTDETIS---NVPILILGNKIDRTDAISEEKLREIKGLYGqttg 159 house mouse
P39110  77 RPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRigyECAVIVVLNKIDLVEDKSELHRRCLLVESE---- 152 Saccharomyces cerevis...
P36405  75 RPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLS---CVPVLIFANKQDLLTAAPASEIAEGLNLHT---- 147 human
P36404  74 RSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLA---GATLLIFANKQDLPGALSSNAIREVLELDS---- 146 human
Q06849  74 RSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLA---GATLLVLCNKQDLPGALSSNEIKEILHLED---- 146 fruit fly
1MOZ_A  76 RPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQ---DAALLVFANKQDQPGALSASEVSKELNLVE---- 148 baker's yeast
1UPT_A  65 RPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAXLEEEELR---KAILVVFANKQDXEQAXTSSEXANSLGLPA---- 137 human
1M2O_B 157 sqrIEg----QRPVEVFMCSVVMRNGYLEAFQWLSQYI 190 baker's yeast
P40617 156 ---LSs----STPWHLQPTCAIIGDGLKEGLEKLHDMI 186 human
Q01475 154 -kgVSkpvpgIRPIEVFMCSVVLRQGYGEGFKWLAQYV 190 Schizosaccharomyces pombe 972h-
P36536 160 kgnVTlkelnARPMEVFMCSVLKRQGYGEGFRWLSQYI 197 house mouse
P39110 153 ---LKclfkpDIRIELVKCSGVTGEGIDNLRDRLVESC 187 Saccharomyces cerevisiae S288c
P36405 148 ---IR-----DRVWQIQSCSALTGEGVQDGMNWVCKNV 177 human
P36404 147 ---IR-----SHHWCIQGCSAVTGENLLPGIDWLLDDI 176 human
Q06849 147 ---IT-----THHWLVAGVSAVTGEKLLSSMDWLIADI 176 fruit fly
1MOZ_A 149 ---LK-----DRSWSIVASSAIKGEGITEGLDWLIDVI 178 baker's yeast
1UPT_A 138 ---LK-----DRKWQIFKTSATKGTGLDEAXEWLVETL 167 human
P40617 156 ---LSs----STPWHLQPTCAIIGDGLKEGLEKLHDMI 186 human
Q01475 154 -kgVSkpvpgIRPIEVFMCSVVLRQGYGEGFKWLAQYV 190 Schizosaccharomyces pombe 972h-
P36536 160 kgnVTlkelnARPMEVFMCSVLKRQGYGEGFRWLSQYI 197 house mouse
P39110 153 ---LKclfkpDIRIELVKCSGVTGEGIDNLRDRLVESC 187 Saccharomyces cerevisiae S288c
P36405 148 ---IR-----DRVWQIQSCSALTGEGVQDGMNWVCKNV 177 human
P36404 147 ---IR-----SHHWCIQGCSAVTGENLLPGIDWLLDDI 176 human
Q06849 147 ---IT-----THHWLVAGVSAVTGEKLLSSMDWLIADI 176 fruit fly
1MOZ_A 149 ---LK-----DRSWSIVASSAIKGEGITEGLDWLIDVI 178 baker's yeast
1UPT_A 138 ---LK-----DRKWQIFKTSATKGTGLDEAXEWLVETL 167 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap