2GDU


Conserved Protein Domain Family
AmyAc_Sucrose_phosphorylase-like

?
cd11343: AmyAc_Sucrose_phosphorylase-like 
Click on image for an interactive view with Cn3D
Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase)
Sucrose phosphorylase is a bacterial enzyme that catalyzes the phosphorolysis of sucrose to yield glucose-1-phosphate and fructose. These enzymes do not have the conserved calcium ion present in other alpha amylase family enzymes. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
Statistics
?
PSSM-Id: 200481
Aligned: 77 rows
Threshold Bit Score: -1
Created: 7-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                         #  #                           
2GDU_A         2 KNKVQLITYADRLgdgTIKSMTDILRTRFDGv-YDGVHILPFFTPFDgaDAGFDPIDHTKVDERLGSWDDVAELSKTHNI 80  Bifidobacterium...
YP_003802639   2 KNGVQLITYPDSLg-iNLEELSTALERYFPDl-FTGIHLLPFYPSSA--DRGFAPLGYDRVDPQFGDWNAVEGLAGRYDI 77  Spirochaeta sma...
CBK74036       5 ENKCMLITYADSMg-dNLSDLTTVMNKHFKDa-VGGIHILPFFPSSG--DRGFAPMDYHVVDPAFGDWNDIEKLAEDYYL 80  Butyrivibrio fi...
ZP_08554373    2 ENKIMLITYADSMg-kDLKDLNNVLNNHFKDt-IGSVHILPFYPSSA--DRGFAPMTYTEVDEVFGDWKDILKISENYEL 77  Haloplasma cont...
ZP_08336178    4 ENKVMLITYADSMg-kNLKELHTVLNTYYRDa-VGGVHILPFFPSSA--DRGFAPMRYDVVDEAFGTYEDIEAIGREYYL 79  Lachnospiraceae...
ADP98617       4 KNAVQLICYPDRIg-nNLKDLYTVVDTHLSEa-IGGLHILPFFPSNA--DGGFSPLTHKEVDPKVGTWDDIEAFTAKYDL 79  marine bacteriu...
ZP_01168805    4 KNQVQLITYPDSLg-gDLKMLNKVMTEHFADifKGGVHILPPFPSSG--DRGFAPLTYLEIDPEFGGWEDIRKIGENFDI 80  Bacillus sp. NR...
ZP_08605244    2 KNKIMLITYSDSFg-kNLKELKQMVDTYFKRe-INGIHILPFFPSSG--DRGFAPINYREVDPQFGTWEDIQALAEDYEL 77  Lachnospiraceae...
YP_001528538   4 RNRIQVISYPDSLg-kNLQELHYVLRRYFADa-AGGVHLLPFYPSSA--DRGFAPVTYYQVDPAFGTWRDIELIQEDFDI 79  Desulfococcus o...
YP_004248465   6 TNRIMLITYPDCFg-qGLKDLRMVLDTDFKGl-FGGLHILPFFPSTA--DRGFSPTTYTEVDPRFGDWDDIMALGEQYYL 81  Spirochaeta sp....
YP_003802639   2 KNGVQLITYPDSLg-iNLEELSTALERYFPDl-FTGIHLLPFYPSSA--DRGFAPLGYDRVDPQFGDWNAVEGLAGRYDI 77  Spirochaeta sma...
CBK74036       5 ENKCMLITYADSMg-dNLSDLTTVMNKHFKDa-VGGIHILPFFPSSG--DRGFAPMDYHVVDPAFGDWNDIEKLAEDYYL 80  Butyrivibrio fi...
ZP_08554373    2 ENKIMLITYADSMg-kDLKDLNNVLNNHFKDt-IGSVHILPFYPSSA--DRGFAPMTYTEVDEVFGDWKDILKISENYEL 77  Haloplasma cont...
ZP_08336178    4 ENKVMLITYADSMg-kNLKELHTVLNTYYRDa-VGGVHILPFFPSSA--DRGFAPMRYDVVDEAFGTYEDIEAIGREYYL 79  Lachnospiraceae...
ADP98617       4 KNAVQLICYPDRIg-nNLKDLYTVVDTHLSEa-IGGLHILPFFPSNA--DGGFSPLTHKEVDPKVGTWDDIEAFTAKYDL 79  marine bacteriu...
ZP_01168805    4 KNQVQLITYPDSLg-gDLKMLNKVMTEHFADifKGGVHILPPFPSSG--DRGFAPLTYLEIDPEFGGWEDIRKIGENFDI 80  Bacillus sp. NR...
ZP_08605244    2 KNKIMLITYSDSFg-kNLKELKQMVDTYFKRe-INGIHILPFFPSSG--DRGFAPINYREVDPQFGTWEDIQALAEDYEL 77  Lachnospiraceae...
YP_001528538   4 RNRIQVISYPDSLg-kNLQELHYVLRRYFADa-AGGVHLLPFYPSSA--DRGFAPVTYYQVDPAFGTWRDIELIQEDFDI 79  Desulfococcus o...
YP_004248465   6 TNRIMLITYPDCFg-qGLKDLRMVLDTDFKGl-FGGLHILPFFPSTA--DRGFSPTTYTEVDPRFGDWDDIMALGEQYYL 81  Spirochaeta sp....
Feature 1               #                                                                        
2GDU_A        81 MVDAIVNHMSWESKQFQDVLAKGEESeyypm-fltmSSVFPNGATEEDLAGIYRPRPGlPFTHYKfa------gkTRLVW 153 Bifidobacterium...
YP_003802639  78 VVDFMVNHISRHSPQFLDFLKRGEKSlwadlflnvrKFHPSGEIPPDDLAKIYTRKPRaPLTKVVhpd-----gsEDTLW 152 Spirochaeta sma...
CBK74036      81 MADYMINHISAQSEYYKDFLAKKDDSkykdlfirykDFWENGEPTEEEVDAIYKRKPRaPYVDANfad-----gtTEKVW 155 Butyrivibrio fi...
ZP_08554373   78 MYDFMINHISRSSKYFQDFLKNKDESsysdlfirykDFWKNGEPTEEQVDKIYKRKPRaPYVIATfed-----gsKEKVW 152 Haloplasma cont...
ZP_08336178   80 MFDFMVNHISSSSEYFQDFLKRKNESkyadffiryeEFWGKGAPTQEQLDKIYKRKPRaPYIEVEfqd-----gtTEKIW 154 Lachnospiraceae...
ADP98617      80 CVDLTVNHISDESPEFTDFIANGFDSeyad---lfvHVDKFGEISPDDMAKIHIRKEKePFREVTlsd-----gtKTRVW 151 marine bacteriu...
ZP_01168805   81 LVDLMVNHISQKSEYFQDFLAKGRQSqyadlfitldKLWEDGQPVQEDIDKMFLRRPL-PYSTFTieetgeqetvWTTFG 159 Bacillus sp. NR...
ZP_08605244   78 MFDFMINHLSRRSPEFLDFLEKHDQSeyadmflrfkKFWPNGEPDQKQVDMLNKRKPCaPCEDILfad-----gtTEKIW 152 Lachnospiraceae...
YP_001528538  80 TIDFMVNHISRQSKYVADFIEKGDKSeyadmflsfnKLAPDGEIRKEDLDKVYTRKPSpPYQVIErpd-----gsRETIW 154 Desulfococcus o...
YP_004248465  82 MYDYMINHLSSESDAFKDFVEKKDASlyrdffirykDFWSNGEPTKQDLERMYRRKQI-PWITVQfnd-----gsQEKLW 155 Spirochaeta sp....
YP_003802639  78 VVDFMVNHISRHSPQFLDFLKRGEKSlwadlflnvrKFHPSGEIPPDDLAKIYTRKPRaPLTKVVhpd-----gsEDTLW 152 Spirochaeta sma...
CBK74036      81 MADYMINHISAQSEYYKDFLAKKDDSkykdlfirykDFWENGEPTEEEVDAIYKRKPRaPYVDANfad-----gtTEKVW 155 Butyrivibrio fi...
ZP_08554373   78 MYDFMINHISRSSKYFQDFLKNKDESsysdlfirykDFWKNGEPTEEQVDKIYKRKPRaPYVIATfed-----gsKEKVW 152 Haloplasma cont...
ZP_08336178   80 MFDFMVNHISSSSEYFQDFLKRKNESkyadffiryeEFWGKGAPTQEQLDKIYKRKPRaPYIEVEfqd-----gtTEKIW 154 Lachnospiraceae...
ADP98617      80 CVDLTVNHISDESPEFTDFIANGFDSeyad---lfvHVDKFGEISPDDMAKIHIRKEKePFREVTlsd-----gtKTRVW 151 marine bacteriu...
ZP_01168805   81 LVDLMVNHISQKSEYFQDFLAKGRQSqyadlfitldKLWEDGQPVQEDIDKMFLRRPL-PYSTFTieetgeqetvWTTFG 159 Bacillus sp. NR...
ZP_08605244   78 MFDFMINHLSRRSPEFLDFLEKHDQSeyadmflrfkKFWPNGEPDQKQVDMLNKRKPCaPCEDILfad-----gtTEKIW 152 Lachnospiraceae...
YP_001528538  80 TIDFMVNHISRQSKYVADFIEKGDKSeyadmflsfnKLAPDGEIRKEDLDKVYTRKPSpPYQVIErpd-----gsRETIW 154 Desulfococcus o...
YP_004248465  82 MYDYMINHLSSESDAFKDFVEKKDASlyrdffirykDFWSNGEPTKQDLERMYRRKQI-PWITVQfnd-----gsQEKLW 155 Spirochaeta sp....
Feature 1          #   #                             # ##  #                                    #
2GDU_A       154 VSFTPQQVDIDTDSDKGWEYLMSIFDQMAASHVSYIRLDAVGYGAKEAGTSCFMT-PKTFKLISRLREEGVKRGLEILIQ 232 Bifidobacterium...
YP_003802639 153 CTFSEEQIDLDIASPVGTAFLEDNLRSLCGHGISMLRLDAFAYVTKRLGTNCFFVePDVWELLHRIQTIVAEYGVEILPE 232 Spirochaeta sma...
CBK74036     156 CTFDEQQIDINCKSATAKEFIKDNLETLCKHGLAMIRLDAFAYATKKAGSSCFFIePEVWELMDESAKIVEPYGVTLLPE 235 Butyrivibrio fi...
ZP_08554373  153 CTFDEEQIDLDVTTDTTKQFVIDNLSFLAKHGANFIRLDAFAYAIKKPDTSCFFIePGVWELLDECQAILKPMGVEMLPE 232 Haloplasma cont...
ZP_08336178  155 CTFCEEQIDLDVRKEAVKSFIKGTLEQMCQNGASLIRLDAFAYAIKKADTNCFFVePDIWELLHEIEQIVGRYEVEILPE 234 Lachnospiraceae...
ADP98617     152 CTFTEQQIDLNYESDLAYQLMESYIGFLTSKGVNLLRLDAFGYTTKRIGTSCFLVePEVYQILDWVNQVALKHGAECLPE 231 marine bacteriu...
ZP_01168805  160 KTDPSEQIDLDIKSEQVRQLLTDFFTNFKEQNVKIVRLDAVGYVVKKLGTSCFFVePEIYEFLDWIMELANSLGIELLPE 239 Bacillus sp. NR...
ZP_08605244  153 CTFDNEQMDLNLESETAWRFVEKTLRFLMDQGAAMIRLDAFAFATKKLNTSCFFIePEMWDMMKRVQGILDEKNIPMLPE 232 Lachnospiraceae...
YP_001528538 155 STFDYEQIDVDVQSPVTRELFRDFLIFLSRRKPEFIRMDAFAYTTIRLGTNCFFVePEVWELLEMLEGFVSPFGVQLLPE 234 Desulfococcus o...
YP_004248465 156 TTFSDYQVDINQNSRVAKQFHADTISFLASHGGTLIRLDAVAYAAKREGTSCFFAePEIWELLQQCADVLKGSNSVVLPE 235 Spirochaeta sp....
YP_003802639 153 CTFSEEQIDLDIASPVGTAFLEDNLRSLCGHGISMLRLDAFAYVTKRLGTNCFFVePDVWELLHRIQTIVAEYGVEILPE 232 Spirochaeta sma...
CBK74036     156 CTFDEQQIDINCKSATAKEFIKDNLETLCKHGLAMIRLDAFAYATKKAGSSCFFIePEVWELMDESAKIVEPYGVTLLPE 235 Butyrivibrio fi...
ZP_08554373  153 CTFDEEQIDLDVTTDTTKQFVIDNLSFLAKHGANFIRLDAFAYAIKKPDTSCFFIePGVWELLDECQAILKPMGVEMLPE 232 Haloplasma cont...
ZP_08336178  155 CTFCEEQIDLDVRKEAVKSFIKGTLEQMCQNGASLIRLDAFAYAIKKADTNCFFVePDIWELLHEIEQIVGRYEVEILPE 234 Lachnospiraceae...
ADP98617     152 CTFTEQQIDLNYESDLAYQLMESYIGFLTSKGVNLLRLDAFGYTTKRIGTSCFLVePEVYQILDWVNQVALKHGAECLPE 231 marine bacteriu...
ZP_01168805  160 KTDPSEQIDLDIKSEQVRQLLTDFFTNFKEQNVKIVRLDAVGYVVKKLGTSCFFVePEIYEFLDWIMELANSLGIELLPE 239 Bacillus sp. NR...
ZP_08605244  153 CTFDNEQMDLNLESETAWRFVEKTLRFLMDQGAAMIRLDAFAFATKKLNTSCFFIePEMWDMMKRVQGILDEKNIPMLPE 232 Lachnospiraceae...
YP_001528538 155 STFDYEQIDVDVQSPVTRELFRDFLIFLSRRKPEFIRMDAFAYTTIRLGTNCFFVePEVWELLEMLEGFVSPFGVQLLPE 234 Desulfococcus o...
YP_004248465 156 TTFSDYQVDINQNSRVAKQFHADTISFLASHGGTLIRLDAVAYAAKREGTSCFFAePEIWELLQQCADVLKGSNSVVLPE 235 Spirochaeta sp....
Feature 1         #                                                      ##                      
2GDU_A       233 VHSYYKKQVEIASKVDRVYDFALPPLLLHALSTGHVEPVAHWTDIRPnNAVTVLDTHDGIGVIDIgsdqldrslKGLVPD 312 Bifidobacterium...
YP_003802639 233 IHEHYSIQLKLANKGYRVYDFALPMLLLHTIFSGSSRRLKEWLKISPhNQITTLDTHDGIGVVDA---------ADLLSS 303 Spirochaeta sma...
CBK74036     236 IHEHYTMQQKIESHDYYVYDFALPMLLINGLYYGQSQYLKHWLEICPrKQFTTLDTHDGIGVVDV---------KDLLPD 306 Butyrivibrio fi...
ZP_08554373  233 IHEHYTIQLNMAKKGCWVYDFALPMLVLYSLFSGKNNRLINWLNICPrKQFTTLDTHDGIGVVDV---------VDLMTD 303 Haloplasma cont...
ZP_08336178  235 IHEHYTIPMKIAEKGFWVYDFALPVLTLHALYNHTGVYLKKWLEMCPmKQFTTLDTHDGIGIVDV---------KDLLPD 305 Lachnospiraceae...
ADP98617     232 VHDHTSYQYAISRRNMHPYGFALPPLLLYSLLDANSTYLKNWLRMCPrNMVTVLDTHDGICIPDV---------EGVLPD 302 marine bacteriu...
ZP_01168805  240 VHSHYSIQHKLAEHGFWIYDFILPYRVLETLINKSSKNLAIYLKNRPhKQFTMLDCHDGIPVKPDl--------DGLIDT 311 Bacillus sp. NR...
ZP_08605244  233 IHDHYTVQQKIADHGYTVYDFVLPVMVLHTLFSQSSRRLRHWLEICPrDQHTTLDTHDGLGTVDV---------EDLLSE 303 Lachnospiraceae...
YP_001528538 235 VHEHYSYQLKLAEKGYWVYDFALPMLVLHTLYHHTNKRLLHWLRICPrRQFTTLDTHDGLGVVDV---------ADLMSQ 305 Desulfococcus o...
YP_004248465 236 IHENYFLQQKVEENGYYVYDFQLPMLVLNALYFGKSRYLKNWLRICPrKQFTTLDTHDGIGVVDA---------RYLMPD 306 Spirochaeta sp....
YP_003802639 233 IHEHYSIQLKLANKGYRVYDFALPMLLLHTIFSGSSRRLKEWLKISPhNQITTLDTHDGIGVVDA---------ADLLSS 303 Spirochaeta sma...
CBK74036     236 IHEHYTMQQKIESHDYYVYDFALPMLLINGLYYGQSQYLKHWLEICPrKQFTTLDTHDGIGVVDV---------KDLLPD 306 Butyrivibrio fi...
ZP_08554373  233 IHEHYTIQLNMAKKGCWVYDFALPMLVLYSLFSGKNNRLINWLNICPrKQFTTLDTHDGIGVVDV---------VDLMTD 303 Haloplasma cont...
ZP_08336178  235 IHEHYTIPMKIAEKGFWVYDFALPVLTLHALYNHTGVYLKKWLEMCPmKQFTTLDTHDGIGIVDV---------KDLLPD 305 Lachnospiraceae...
ADP98617     232 VHDHTSYQYAISRRNMHPYGFALPPLLLYSLLDANSTYLKNWLRMCPrNMVTVLDTHDGICIPDV---------EGVLPD 302 marine bacteriu...
ZP_01168805  240 VHSHYSIQHKLAEHGFWIYDFILPYRVLETLINKSSKNLAIYLKNRPhKQFTMLDCHDGIPVKPDl--------DGLIDT 311 Bacillus sp. NR...
ZP_08605244  233 IHDHYTVQQKIADHGYTVYDFVLPVMVLHTLFSQSSRRLRHWLEICPrDQHTTLDTHDGLGTVDV---------EDLLSE 303 Lachnospiraceae...
YP_001528538 235 VHEHYSYQLKLAEKGYWVYDFALPMLVLHTLYHHTNKRLLHWLRICPrRQFTTLDTHDGLGVVDV---------ADLMSQ 305 Desulfococcus o...
YP_004248465 236 IHENYFLQQKVEENGYYVYDFQLPMLVLNALYFGKSRYLKNWLRICPrKQFTTLDTHDGIGVVDA---------RYLMPD 306 Spirochaeta sp....
Feature 1                                        ##  #                                           
2GDU_A       313 EDVDNLVNTIHANTHGEsq----aaTGAAASNLDLYQVNSTYYSALGXNDQHYIAARAVQFFLPGVPQVYYVGALAGKND 388 Bifidobacterium...
YP_003802639 304 EEIEKTVDALYERGSNVnr----rySSEEYNNLDIYQINCTYYSATGEDDDAYILSRAIQFFAPGIPQVYYVGALSGRND 379 Spirochaeta sma...
CBK74036     307 EEIERTKEDIFKFGANVkk----iyNTAAYNNLDIYQVNCSYYSALGDDDDAYLLARAVQFFAPGIPQVYYVGLLAGKND 382 Butyrivibrio fi...
ZP_08554373  304 KEIDYTKEVLYKKGANVkk----kySSAEYKNLDIYQINCTYYSALGNNDAAYLLARAIQFFAPGIPQVYYVGLLAGEND 379 Haloplasma cont...
ZP_08336178  306 EEVYIVQEQMYRQGANVkk----iySSESYNNLDVYQVNTTYYSALGNRDDAYLLARAIQFFAPGIPQVYYVGLLAGEND 381 Lachnospiraceae...
ADP98617     303 EKIKVLIDNIDARSADPimr---rsAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQFFTPGIPQVYYVGLLAGCND 379 marine bacteriu...
ZP_01168805  312 KEAKDIVDVCLERGSNLsli--lsdEHKAEDGFDVHQIRCSYYSVLNSDDDAYLAARAIQFFTPGVPQVYYVGLLAGEND 389 Bacillus sp. NR...
ZP_08605244  304 EELQAVIDKTEEYGANFkw----dySQKGHGGKRVYQINCSYYSAVGEDDDSYLLSRAIQFFTPGVPQVYYMGLLAGEND 379 Lachnospiraceae...
YP_001528538 306 EEIERTVDGLYEKGSNIkr----iySTADYQNLDIYQVNCTYYSALERNDDSYLAARTLQFYAPGIPHVYYVGLLAGEND 381 Desulfococcus o...
YP_004248465 307 EELLATRRRCFEMNPDVyamyahsgIKIDLDAFDTYQINCTYYSACGADDWQYYIARAIQFFAPGIPQVYYVGLLAGEND 386 Spirochaeta sp....
YP_003802639 304 EEIEKTVDALYERGSNVnr----rySSEEYNNLDIYQINCTYYSATGEDDDAYILSRAIQFFAPGIPQVYYVGALSGRND 379 Spirochaeta sma...
CBK74036     307 EEIERTKEDIFKFGANVkk----iyNTAAYNNLDIYQVNCSYYSALGDDDDAYLLARAVQFFAPGIPQVYYVGLLAGKND 382 Butyrivibrio fi...
ZP_08554373  304 KEIDYTKEVLYKKGANVkk----kySSAEYKNLDIYQINCTYYSALGNNDAAYLLARAIQFFAPGIPQVYYVGLLAGEND 379 Haloplasma cont...
ZP_08336178  306 EEVYIVQEQMYRQGANVkk----iySSESYNNLDVYQVNTTYYSALGNRDDAYLLARAIQFFAPGIPQVYYVGLLAGEND 381 Lachnospiraceae...
ADP98617     303 EKIKVLIDNIDARSADPimr---rsAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQFFTPGIPQVYYVGLLAGCND 379 marine bacteriu...
ZP_01168805  312 KEAKDIVDVCLERGSNLsli--lsdEHKAEDGFDVHQIRCSYYSVLNSDDDAYLAARAIQFFTPGVPQVYYVGLLAGEND 389 Bacillus sp. NR...
ZP_08605244  304 EELQAVIDKTEEYGANFkw----dySQKGHGGKRVYQINCSYYSAVGEDDDSYLLSRAIQFFTPGVPQVYYMGLLAGEND 379 Lachnospiraceae...
YP_001528538 306 EEIERTVDGLYEKGSNIkr----iySTADYQNLDIYQVNCTYYSALERNDDSYLAARTLQFYAPGIPHVYYVGLLAGEND 381 Desulfococcus o...
YP_004248465 307 EELLATRRRCFEMNPDVyamyahsgIKIDLDAFDTYQINCTYYSACGADDWQYYIARAIQFFAPGIPQVYYVGLLAGEND 386 Spirochaeta sp....
Feature 1                  #                                           
2GDU_A       389 MELLRKTNNGRDINRHYYSTAEIDENLKRPVVKALNALAKFRNELDAFDGTFSY 442 Bifidobacterium adolescentis
YP_003802639 380 TDLIEQTKQGRDINRHPYGLDEIAVEIERPVNKRLFRLMRFRSHTPAFEGSFSL 433 Spirochaeta smaragdinae DSM 11293
CBK74036     383 LQLLEETKVGRNINRHYYKLDEIDREVERPVVKKLLELMKFRNEHSAFDGEFIL 436 Butyrivibrio fibrisolvens 16/4
ZP_08554373  380 LELLEKTKVGRNINRHYYTVDEINERVTDPMLQNMYKLMEFRNTYDAFNGDVTI 433 Haloplasma contractile SSD-17B
ZP_08336178  382 LELMEKTKNGRDINRHYYTLEEIAGEQERPVVRKLKKLMAIRNMEPAFHLDGKI 435 Lachnospiraceae bacterium 9_1_43BFAA
ADP98617     380 HELMEQSGELRDINRHYYTLEEVEQDIQKPVVQRLLSLMKFRSNYPAFDGHFEL 433 marine bacterium HP15
ZP_01168805  390 VENVARTGEGREINRHNFTLEEIEESLEKPVVQRLLKLIRFRNENEAFSGEFQV 443 Bacillus sp. NRRL B-14911
ZP_08605244  380 YELMERTQYDRNISRHNYTVEEIETLVEKPVVKKLCRLMQFRNEYPVFDGEMSL 433 Lachnospiraceae bacterium 3_1_57FAA_CT1
YP_001528538 382 VALVEATRNGRDINRHNYTLDEIAVAVEREVVQRLIRLMRFRSSYPAFDGELVI 435 Desulfococcus oleovorans Hxd3
YP_004248465 387 FELYNQTQQNRDVNRSYYSLLDVKENMKRPIVQKLMRLMAFRNTHPAFNGDFEV 440 Spirochaeta sp. Buddy
YP_003802639 380 TDLIEQTKQGRDINRHPYGLDEIAVEIERPVNKRLFRLMRFRSHTPAFEGSFSL 433 Spirochaeta smaragdinae DSM 11293
CBK74036     383 LQLLEETKVGRNINRHYYKLDEIDREVERPVVKKLLELMKFRNEHSAFDGEFIL 436 Butyrivibrio fibrisolvens 16/4
ZP_08554373  380 LELLEKTKVGRNINRHYYTVDEINERVTDPMLQNMYKLMEFRNTYDAFNGDVTI 433 Haloplasma contractile SSD-17B
ZP_08336178  382 LELMEKTKNGRDINRHYYTLEEIAGEQERPVVRKLKKLMAIRNMEPAFHLDGKI 435 Lachnospiraceae bacterium 9_1_43BFAA
ADP98617     380 HELMEQSGELRDINRHYYTLEEVEQDIQKPVVQRLLSLMKFRSNYPAFDGHFEL 433 marine bacterium HP15
ZP_01168805  390 VENVARTGEGREINRHNFTLEEIEESLEKPVVQRLLKLIRFRNENEAFSGEFQV 443 Bacillus sp. NRRL B-14911
ZP_08605244  380 YELMERTQYDRNISRHNYTVEEIETLVEKPVVKKLCRLMQFRNEYPVFDGEMSL 433 Lachnospiraceae bacterium 3_1_57FAA_CT1
YP_001528538 382 VALVEATRNGRDINRHNYTLDEIAVAVEREVVQRLIRLMRFRSSYPAFDGELVI 435 Desulfococcus oleovorans Hxd3
YP_004248465 387 FELYNQTQQNRDVNRSYYSLLDVKENMKRPIVQKLMRLMAFRNTHPAFNGDFEV 440 Spirochaeta sp. Buddy

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap