Conserved Protein Domain Family
GST_C_GDAP1L1

?
cd10302: GST_C_GDAP1L1 
C-terminal, alpha helical domain of Ganglioside-induced differentiation-associated protein 1-like 1
Glutathione S-transferase (GST) C-terminal domain family, Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1) subfamily; GDAP1L1 is a paralogue of GDAP1 with about 56% sequence identity and 70% similarity. It's function is unknown. Like GDAP1, it does not exhibit GST activity using standard substrates. GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells. More recently, mutations in GDAP1 have been reported to cause both axonal and demyelinating autosomal-recessive Charcot-Marie-Tooth (CMT) type 4A neuropathy. CMT is characterized by slow and progressive weakness and atrophy of muscles. Sequence analysis of GDAP1 shows similarities and differences with GSTs; it appears to contain both N-terminal thioredoxin-fold and C-terminal alpha helical domains of GSTs, however, it also contains additional C-terminal transmembrane domains unlike GSTs. GDAP1 is mainly expressed in neuronal cells and is localized in the mitochondria through its transmembrane domains.
Links
?
Statistics
?
PSSM-Id: 198335
View PSSM: cd10302
Aligned: 4 rows
Threshold Bit Score: 234.903
Threshold Setting Gi: 56203980
Created: 13-May-2011
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Hierarchy
?
Display:
 
putative dimerputative
Feature 1:putative dimer interface [polypeptide binding site]
Evidence:
  • Comment:Based on dimer structures of other family members.
  • Comment:Residues from both N-terminal TRX-fold and C-terminal alpha helical domains form the dimer interface.
  • Citation:PMID 9680481

cd10302 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd10302 is a member of the superfamily cl02776.
cd00299:GST_C_familycd03177:GST_C_Delta_Epsiloncd03178:GST_C_Ure2p_likecd03180:GST_C_2cd03181:GST_C_EF1Bgamma_likecd03182:GST_C_GTT2_likecd03183:GST_C_Thetacd03184:GST_C_Omegacd03185:GST_C_Taucd03186:GST_C_SspAcd03187:GST_C_Phicd03188:GST_C_Betacd03189:GST_C_GTT1_likecd03190:GST_C_Omega_likecd03191:GST_C_Zetacd03192:GST_C_Sigma_likecd03193:GST_C_Metaxincd03194:GST_C_3cd03195:GST_C_4cd03196:GST_C_5cd03197:GST_C_mPGES2cd03198:GST_C_CLICcd03199:GST_C_GRX2cd03200:GST_C_AIMP2cd03201:GST_C_DHARcd03202:GST_C_etherase_LigEcd03203:GST_C_Lambdacd03204:GST_C_GDAP1_likecd03205:GST_C_6cd03206:GST_C_7cd03207:GST_C_8cd03208:GST_C_Alphacd03209:GST_C_Mucd03210:GST_C_Picd03211:GST_C_Metaxin2cd03212:GST_C_Metaxin1_3cd10289:GST_C_AaRS_likecd10290:GST_C_MetRS_N_fungicd10291:GST_C_YfcG_likecd10292:GST_C_YghU_likecd10293:GST_C_Ure2pcd10294:GST_C_ValRS_Ncd10295:GST_C_Sigmacd10296:GST_C_CLIC4cd10297:GST_C_CLIC5cd10298:GST_C_CLIC2cd10299:GST_C_CLIC3cd10300:GST_C_CLIC1cd10301:GST_C_CLIC6cd10302:GST_C_GDAP1L1cd10303:GST_C_GDAP1cd10304:GST_C_Arc1p_N_likecd10305:GST_C_AIMP3cd10306:GST_C_GluRS_Ncd10307:GST_C_MetRS_Ncd10308:GST_C_eEF1b_likecd10309:GST_C_GluProRS_Ncd10310:GST_C_CysRS_Ncd10424:GST_C_911840396068402792562039801181006091184039606840279256203980118100609
cd10302 Sequence Cluster
cd10302 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd10302 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ##  ##  #                             #                                        
gi 56203980  201 PQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENegQKCELWLCGCAFTLADVLLGATLHRL 280
gi 68402792  201 PQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAMVLDQVEAELEKRKLEYqgQKCELWLCGPTFTLADICLGATLHRL 280
gi 118403960 198 PQLMEPYLSKQKKLMAKILEHDNVNYLTKILIQLSMVLDQIEAELEKRKLEYegQKCELWLCGHIFTLADVLLGATLHRL 277
gi 118100609 104 PPLTEPYLSKQKKLMAKILEHDNVNYLKKILGELGMVLDQIEAELEKRKLEYqgQKCELWLCGCVFTLADILLGATLHRL 183
                         90       100       110
                 ....*....|....*....|....*....|.
Feature 1                                       
gi 56203980  281 KFLGLSKKYWEDGSRPNLQSFFERVQRRFAF 311
gi 68402792  281 KFLGLSRKYWEDGSRPNLQSFFERVQKRYAF 311
gi 118403960 278 KFLGLSKKYWEDGSRPNLQLFFDRIQKRYAF 308
gi 118100609 184 KFLGLSKKYWEDGSRPNLQSFFDRIQKRFAF 214

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap