Conserved Protein Domain Family
Connexin_CCC

?
smart01089: Connexin_CCC 
Click on image for an interactive view with Cn3D
Gap junction channel protein cysteine-rich domain
Statistics
?
PSSM-Id: 198157
View PSSM: smart01089
Aligned: 111 rows
Threshold Bit Score: 66.7427
Threshold Setting Gi: 198420751
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
smart01089 is a member of the superfamily cl27767.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3IZ1_A       146 FEAAFMYVFY--VMYd----------------------GFSMQRLVKCN-AW---P-------C-----P---N----T- 177
gi 198435203 170 IECVFIMLQYtvYFY-----------------------RWTVPQVFRCQ-VW---P-------C-----P---H----T- 202
gi 28175212   28 LEGAALGLQY--HLY-----------------------GFQMPSSFACR-RE---P-------C-----L---G----S- 58
gi 20379172  148 LEGAALGVQY--NLY-----------------------GFKMSSTFICR-ED---P-------C-----I---G----S- 178
gi 47192004  160 LEVIAFWLQS--HLF-----------------------GFQVHPLYMCD-AS---A-------L-----EktfN----V- 193
gi 308153309 125 LEVSAFWLQI--HLF-----------------------GFQVKPVYLCD-AE---S-------Lgq--kI---N----T- 158
gi 125841208 125 LEVAAFWLQS--RLF-----------------------GFLVHPLYSCD-SR---P-------Lds--rL---N----F- 158
gi 334324231 125 LEVIAFWLQS--HLF-----------------------GFQVKSLYHCD-ASlleK-------R-----L---G----I- 158
gi 332825106 126 LAAIAFWLQI--YLF-----------------------GFQVKSLYLCDaRS---L-------G-----E---N----Mn 158
gi 198435488 180 LEGGFIYLGY--VLYnipiyascvgpncnarstiasvlWMKVPSEYRCI-GA---PgsevyniCnmhygP---NaergY- 249
                         90       100       110
                 ....*....|....*....|....*....|....*.
3IZ1_A       178 VDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYL 213
gi 198435203 203 VDCFISRPQEKTVFFRYMYVISAFSILLSIGELLYI 238
gi 28175212   59 ITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLL 94
gi 20379172  179 TTCFQSHPSEKTIFLNIMFGISGACFLFIFLELALL 214
gi 47192004  194 TKCMVPEHFEKTIFLSAMYTFTVITILLCVAEIFEI 229
gi 308153309 159 LKCMVPEHFEKTIFLIAMYTFTVITMVLCVAEIFEI 194
gi 125841208 159 TKCMVPEHFEKTIFLSAMYTFTIITMILCVAEIFEI 194
gi 334324231 159 IRCLVPEHFEKTIFLIAMYTFTAVTVALGFAEVFEI 194
gi 332825106 159 IRCMVPEHFEKTIFLIAINTFTTITILLFVAEIFEI 194
gi 198435488 250 VPCITSRATEKTVFLRYMTILSVICFILSALELIYL 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap