Conserved Protein Domain Family
Col_cuticle_N

?
smart01088: Col_cuticle_N 
Nematode cuticle collagen N-terminal domain
The function of this domain is unknown. It is found in the N-terminal region of nematode cuticle collagens. Cuticle is a tough elastic structure secreted by hypodermal cells and is primarily composed of collagen proteins.
Statistics
?
PSSM-Id: 198156
View PSSM: smart01088
Aligned: 118 rows
Threshold Bit Score: 43.9949
Threshold Setting Gi: 17540734
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_491106      3 KFVIGSVSTAAFfVSVCTIYFSVSMLDELDSFRLSIRDELEDWKEVSDDTWQRL 56  nematode
NP_499889      9 TSTIVGSVVSTF-AVLTVIIGLPLMHNHVQKVTTLMLTEVELCKTESQDIWKQM 61  nematode
XP_003108002   8 RAGFTACVFSGG-AILVCLVYVPSLVTKIQNINDQLKVDSEEFRAMADYTWREL 60  Caenorhabditis remanei
NP_500070      5 VAGYAAIAFSLS-SLFLVSTFVPALWNKINDITGELHYDMNEFRDLHNEVWANM 57  nematode
NP_872207     19 sVALGAVTITAF-SLGTSILLLPLLFSHAQTVQSTLEHELQFCVLRSHDLFDEL 71  nematode
NP_495726     11 LVV--STVISTF-TFLATITLLPLFYMKVQRINSQMLTDLRNCHQDSTDIWKQL 61  nematode
NP_496367     22 VVTLISVGITVA-AILLGLFGSVILFAKTLTFQNELEYELRYCVSRSHDLWDIL 74  nematode
NP_498086      4 FAGYAACTLGAV-SMLLCVSLVPQVYQQVSMLRDELTTEMEAWRLESDQIYMDM 56  nematode
NP_508873      8 AVA--SIVLSTF-TLVVAVFSVPMLFHKSDNVLLEISSFSDGIKAKSDLVWNEL 58  nematode
NP_508386     13 VSF--AVILSGS-AFLIMVTATPVLFYTMGDMTAQLETAKTGFEETSNVLWKEL 63  nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap