2V0F,2DL6


Conserved Protein Domain Family
BRK

?
smart00592: BRK 
Click on image for an interactive view with Cn3D
domain in transcription and CHROMO domain helicases
Statistics
?
PSSM-Id: 197800
Aligned: 16 rows
Threshold Bit Score: 43.1051
Threshold Setting Gi: 119596382
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2V0F_A         14 TGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWT 58   human
XP_003219644 2644 TGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWT 2688 green anole
XP_002041546 1981 TGEEPVPVINKQTGKRLGGNKAPQLKRLMQWLTENPNYEVDPKWL 2025 Drosophila sechellia
AAC60670       20 MSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSD 64   mice
XP_002807783 2555 TGEERVQLINRRNARKVGGAFAPPLKDLCRFLKENSEYGVAPEWG 2599 white-tufted-ear marmoset
XP_003213556  242 MSDLPVKVTHTETGKVLLGPEAPKASQLDAWLEMNPGYEVAPRSD 286  turkey
NP_502082     404 DEEARVHVRERSTGKALTGDQAPKTEEIEFWLETHPEYEIVPRDQ 448  nematode
ACX70080      268 SKVERINVFERKSGRVITGHMAPSAHQFRKWLQENPSFEVLPSGT 312  fruit fly
AAC17559     2668 QFDDMISVFNRKTGELLAASKWPKATELSAWLDANPDYNVHANSA 2712 nematode
XP_001096619 2100 LGMEPVQTANSRNGKKG----HHTETVFNRVLPGPIAPESSKKRA 2140 rhesus monkey
XP_003219644 2644 TGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWT 2688 green anole
XP_002041546 1981 TGEEPVPVINKQTGKRLGGNKAPQLKRLMQWLTENPNYEVDPKWL 2025 Drosophila sechellia
AAC60670       20 MSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSD 64   mice
XP_002807783 2555 TGEERVQLINRRNARKVGGAFAPPLKDLCRFLKENSEYGVAPEWG 2599 white-tufted-ear marmoset
XP_003213556  242 MSDLPVKVTHTETGKVLLGPEAPKASQLDAWLEMNPGYEVAPRSD 286  turkey
NP_502082     404 DEEARVHVRERSTGKALTGDQAPKTEEIEFWLETHPEYEIVPRDQ 448  nematode
ACX70080      268 SKVERINVFERKSGRVITGHMAPSAHQFRKWLQENPSFEVLPSGT 312  fruit fly
AAC17559     2668 QFDDMISVFNRKTGELLAASKWPKATELSAWLDANPDYNVHANSA 2712 nematode
XP_001096619 2100 LGMEPVQTANSRNGKKG----HHTETVFNRVLPGPIAPESSKKRA 2140 rhesus monkey
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap