1ID3


Conserved Protein Domain Family
H2B

?
smart00427: H2B 
Click on image for an interactive view with Cn3D
Histone H2B
Statistics
?
PSSM-Id: 197718
View PSSM: smart00427
Aligned: 7 rows
Threshold Bit Score: 147.278
Threshold Setting Gi: 115434590
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ID3_D        30 KKRSKVRKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGEL 109 baker's yeast
XP_001178716  25 KKRNRKRKESYGIYIYKVLKQVHPDTGISSRAMVIMNSFVNDIFERIAGESSRLAQYNKKSTISSREIQTAVRLILPGEL 104 purple urchin
NP_001042053  58 RKKAKKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSREIQTSVRLVLPGEL 137 Japanese rice
P27795        16 KKSHRKPKRTWNVYINRSLKSINNHMSMSGRTMKIVNSFVNDLFERIACEAATVVRVNKKRTLGARELQTAVRLVLPADL 95  Trypanosoma cruzi
P40284        29 KREVKKNFDSYALYISRVLKSVFPDIGITLPSISVMDSFVRDIFERIAMDASSLTRNYQKSTLTTKEIETATKLILKGDL 108 Entamoeba invadens
P08994        23 KKNKKKRSETFAIYIFKVLKQVHPDVGISKKAMNIMNSFINDSFERIALESSKLVRFNKRRTLSSREVQTAVKLLLPGEL 102 Tetrahymena the...
P02290        47 VKRRRRRRESYGIYIYKVLKQVHPDTGISSRAMSVMNSFVNDVFERIAAEAGRLTTYNRRSTVSSREVQTAVRLLLPGEL 126 angulate urchin
1ID3_D       110 AKHAVSEGTRAVTKYSS 126 baker's yeast
XP_001178716 105 AKHAVSEGTKAVTKYTT 121 purple urchin
NP_001042053 138 AKHAVSEGTKAVTKFTS 154 Japanese rice
P27795        96 AKHAMAEGTKAVSHASS 112 Trypanosoma cruzi
P40284       109 NKHAVSEGQSAVKRAQG 125 Entamoeba invadens
P08994       103 ARHAISEGTKAVTKFSS 119 Tetrahymena thermophila
P02290       127 AKHAVSEGTKAVTKYTT 143 angulate urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap