1KY2,1Z0A,1Z0F,2FU5,3BFK,1YU9,2G6B,1TU3,2IL1,3RAB,1VG0,1S8F,3BC1,3BBP


Conserved Protein Domain Family
RAB

?
smart00175: RAB 
Click on image for an interactive view with Cn3D
Rab subfamily of small GTPases
Rab GTPases are implicated in vesicle trafficking.
Statistics
?
PSSM-Id: 197555
View PSSM: smart00175
Aligned: 61 rows
Threshold Bit Score: 226.235
Threshold Setting Gi: 73987970
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KY2_A         9 LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVdGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLV 88
gi 148704501  12 FRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEV-DGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLV 90
gi 268575806  12 LKILIIGESGVGKSSLMLRFVDDVFDPEQAATIGVDFRVTSMTI-DGNRVKLAIWDTAGQERFRTLTPSYYRGAQGVICV 90
gi 302855274  10 FKVLLVGDSGVGKSCILTRFTSGIFEESTTSTIGVDFKVKYLTA-DGKRCKLTIWDTAGQERFRTLTSSYYRGAQGIIFV 88
gi 1370172    12 FKILLIGDSGVGKSSLLVSFISSSVEDQS-PTIGVDFKIKMLTV-GGKRLKLTLWDTAGQERFRTLTSSYYRGAQGIILV 89
gi 1370174    12 FKLLMIGDSGVGKSSLLLSFTSDEFQDMS-PTIGVDFKVKYVAI-GGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMV 89
gi 464565     10 lkiliiGESGVGKSSLLLRFTEDTFDPEQAATIGVDFKVKTLTV-EGNKTKLAIWDTAGQERFRTLTPSYYRGAQGVILV 88
gi 73611940   15 LKFLLVGDRDVGKSEILESLQDGTAESPYSHLGGIDYKTTTILL-DGQRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILV 93
gi 2313043     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQV-DGIDYKVALWDTAGAERFRSLTASFYRKALGAILV 84
2IL1_A        27 LQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVEL-RGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILV 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KY2_A        89 YDVTNASSFENIK-S-WRDEFLVHA-N-VnspeTFPFVILGNKIDAEEsKKIVSEKSAQELaKSL-GDIPLFLTSAKNAI 163
gi 148704501  91 YDISSERSYQHIM-K-WVSDVDEYA-P-E----GVQKILIGNKADEEQ-KRQVGREQGQQL-AKE-YGMDFYETSACTNL 159
gi 268575806  91 YDVTSRSSFEKLK-H-WMTEVDTYCtN-D----NVIKMMVANKIDMPN--RTVTREEGLKF-AKR-HRTLFIEASAKTKE 159
gi 302855274  89 YDVTRRDTFESLEaN-WMREFDIYS-TvE----SAIKMVVANKVDLSA-QRQVSSEEGHDF-ARR-HGCLFVETSARANL 159
gi 1370172    90 YDVTKRETFTNLS-EvWSKELELYS-N-Nq---DCVKMLVGNKVDRDA-ARAVSREEGLAL-AKE-LGCLLIECSAKTRE 160
gi 1370174    90 YDVTRRDTFTNLS-EiWAKEIDLYStN-Q----DCIKMLVGNKVDKES-DRVVSKKEGIDF-ARE-YGCLFIECSAKTRV 160
gi 464565     89 YDVSSKQSFNKLD-A-WLNELETFS-T-Kh---DMVKMLVGNKIDRAN--HEVTKDEGLKF-ARK-HHMLFIEASAKTND 157
gi 73611940   94 YDIANRWSFEGMD-R-WIKKIEEHA---P----GVPKILVGNRLHLAF-KRQVPREQAQAY-AER-LGVTFFEVSPLCNF 161
gi 2313043    85 YDITSRDSLVKLE-T-WLAELDSYS-DnP----NIAIIVVGNKIDEE---RVVDREEGRKF-ARK-HRALFIETSAKCDQ 152
2IL1_A       106 YDITKKETFDDLP-K-WMKMIDKYA-S-E----DAELLLVGNKLDCET-DREITRQQGEKF-AQQiTGMRFCEASAKDNF 175
                        170
                 ....*....|....*.
1KY2_A       164 NVDTAFEEIARSALQQ 179
gi 148704501 160 NIKESFTRLTELVLQa 175
gi 268575806 160 GVQCTFEELIEKIIQT 175
gi 302855274 160 AVGQAFEELLLKILDT 175
gi 1370172   161 NVEQCFEELALKIMea 176
gi 1370174   161 NVQQCFEELVLKILDT 176
gi 464565    158 GVQCAFEELVEKIIQT 173
gi 73611940  162 NIIESFTELARIVLLR 177
gi 2313043   153 FVSDVFKDVVEKIVSs 168
2IL1_A       176 NVDEIFLKLVDDILKK 191
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap