2ATX,2NTY,1I4D,1LB1,1DOA,3A58,2J1L,1GWN,3Q3J


Conserved Protein Domain Family
RHO

?
smart00174: RHO 
Click on image for an interactive view with Cn3D
Rho (Ras homology) subfamily of Ras-like small GTPases
Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Statistics
?
PSSM-Id: 197554
View PSSM: smart00174
Aligned: 43 rows
Threshold Bit Score: 240.208
Threshold Setting Gi: 400978
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ATX_A        21 CVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTV-GGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSV 99
gi 301775707  26 IVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEI-DTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDI 104
gi 119581323  10 IVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEI-DKRRIELNMWDTSGSSYYDNVRPLAYPDSDAVLICFDI 88
gi 7657514    16 LVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLET-EEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDI 94
gi 6671573    20 VVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQM-KGKPVHLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDV 98
gi 416842     78 IVVVGDGGCGKTCLLLAYTQNKFPSIYVPTVFENYVTAVQSpNGKTVELALWDTAGQEEYDRLRPLSYPDVDILLVCFAV 157
gi 218474     19 IVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV-DSKHITLSLWDTAGQEEFDRLRSLSYSDTQCIMLCFSI 97
gi 172422     10 LVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDSRV-DGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAV 88
2J1L_A        37 VVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQV-KGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDV 115
1GWN_A        31 IVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEI-DTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDI 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2ATX_A       100 VNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRd---dPKTLARLNDMKEKPICVEQGQ------------------ 158
gi 301775707 105 SRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRt---dVSTLVELSNHRQTPVSYDQGA------------------ 163
gi 119581323  89 SRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRt---dLATLRELSKQRLIPVTHEQGTv----------------- 148
gi 7657514    95 SRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRt---dLSTLMELSHQKQAPISYEQGCa----------------- 154
gi 6671573    99 TNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRk---dKVLVNNLRKKRLEPVTYHRGHd----------------- 158
gi 416842    158 DNEVSLENVKDMWFPEVNHYCPGIPIILVGTKSDLL-----SDMNHDASIR----------------------------- 203
gi 218474     98 DSRDSLENVQNKWVGEITDHCEGVKLVLVALECDLRnneneSNAITPNNIQQDNSVSNDNGNninstsngknlisyeegl 177
gi 172422     89 DNFESLINARTKWADEALRYCPDAPIVLVGLKKDLRq---eAHFKENAT-DEMVPIEDAKQ------------------- 145
2J1L_A       116 TSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRk---dKSLVNKLRRNGLEPVTYHRGQ------------------ 174
1GWN_A       110 SRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRt---dVSTLVELSNHRQTPVSYDQGA------------------ 168
                        170       180       190
                 ....*....|....*....|....*....|....*..
2ATX_A       159 KLAKEIGACCYVECSALTQKG-LKTVFDEAIIAILTP 194
gi 301775707 164 NMAKQIGAATYIECSALQSENsVRDIFHVATLACVNK 200
gi 119581323 149 -LAKQVGAVSYVECSSRSSERsVRDVFHVATVASLGR 184
gi 7657514   155 -IAKQLGAEIYLEGSAFTSEKsIHSIFRTASMLCLNK 190
gi 6671573   159 -MARSVGAVAYLECSARLHDN-VEAVFQEAAEVALSS 193
gi 416842    204 -VAKEIGAIGLIFTSAKTMFN-VRTVFNFALNHfqrn 238
gi 218474    178 AMAKKIGALRYLECSAKLNKG-VNEAFTEAARVALTA 213
gi 172422    146 -VARAIGAKKYMECSALTGEG-VDDVFEVATRTSLLM 180
2J1L_A       175 EMARSVGAVAYLECSARLHDN-VHAVFQEAAEVALSs 210
1GWN_A       169 NMAKQIGAATYIECSALQSENsVRDIFHVATLACVNK 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap