2A78,2ERY,1X1R,3BRW,1CLU,2FN4,1XTQ,3RAP


Conserved Protein Domain Family
small_GTPase

?
smart00010: small_GTPase 
Click on image for an interactive view with Cn3D
Small GTPase of the Ras superfamily; ill-defined subfamily
SMART predicts Ras-like small GTPases of the ARF, RAB, RAN, RAS, and SAR subfamilies. Others that could not be classified in this way are predicted to be members of the small GTPase superfamily without predictions of the subfamily.
Statistics
?
PSSM-Id: 197466
View PSSM: smart00010
Aligned: 39 rows
Threshold Bit Score: 233.991
Threshold Setting Gi: 34870797
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2A78_A        17 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCV 96
gi 5032041     5 KSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILV 84
gi 34870797   23 NCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILV 102
gi 8408        2 REYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVKVNERQCMLEIVNTAGTEQFTAMRNLYMKNGSDSCWS 81
gi 405068      4 KDYKIVVLGSGAVGKSSITVRFVQGIFLVKYDPTIEDSYRKQLDLDGQQYVLEILDTAGTEQFTAMRDLYMKTGQGFVLV 83
gi 17553566   12 LNRKVAVMGYPHVGKSALVLRFTQNIFPERYESTIEDQHSKHIAAFHRDYHLRVTDTAGQQEYTVFPRSCSLDINGFILV 91
gi 17136706    2 REYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLV 81
gi 118084698 222 REYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDASPSVLEILDTAGTEQFASMRDLYIKNGQGFILV 301
3BRW_D         2 REYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALV 81
1XTQ_A         5 KSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILV 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2A78_A        97 FSITEMESFAATADFREQILRVKED--------ENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQW-N--VNYVETSAKTR 165
gi 5032041    85 YSVTSIKSFEVIKVIHGKLLDMVGK--------VQIPIMLVGNKKDLHMERVISYEEGKALAESW-N--AAFLESSAKEN 153
gi 34870797  103 FSLDNRDSFEEVQRLKQQILDTKSClknktkenVDVPLVICGNKGDRDFYREVEQREIEQLVGDD-PqrCAYFEISAKKN 181
gi 8408       82 TRSRRNRRLTICRTREQILRVKDTD---------DVPMVLVGNKCDLEEERVVGKELGKNLATQF-N--CAFMETSAKAK 149
gi 405068     84 YSIMAQSTYNDLDPIHDQIVRVRDT--------ENVPIIVVGNKCDLESQRIVSQDDGKALADKY-G--AEFLEVSAKAE 152
gi 17553566   92 YAIDDRKSFEMCSNIYEKIVRTYGD--------TSIPIVIVGNKTDLSTQRVVRAEEGEELARQW-D--AKFVEITARES 160
gi 17136706   82 YSITAQSTFNDLQDLREQILRVKDT--------DDVPMVLVGNKCDLEEERVVGKELGKNLATQF-N--CAFMETSAKAK 150
gi 118084698 302 YSLVNQQSFQDIRPMRDQIIRVKRY--------EKVPVILVGNKVDLESEREVSSNEGRALAEEW-G--CPFMETSAKSK 370
3BRW_D        82 YSITAQSTFNDLQDLREQILRVKDT--------DDVPMILVGNKCDLEDERVVGKEQGQNLARQWnN--CAFLESSAKSK 151
1XTQ_A        85 YSVTSIKSFEVIKVIHGKLLDMVGK--------VQIPIMLVGNKKDLHMERVISYEEGKALAESW-N--AAFLESSAKEN 153
                        170
                 ....*....|....*..
2A78_A       166 ANVDKVFFDLMREIRAR 182
gi 5032041   154 QTAVDVFRRIILEAEKM 170
gi 34870797  182 SSLDQMFRALFAMAKLP 198
gi 8408      150 VNVNDIFYDWsgrstrs 166
gi 405068    153 IRISDIFTTLIKRINAM 169
gi 17553566  161 NRVHEVFELLLREIEIS 177
gi 17136706  151 VNVNDIFYDLVRQINkk 167
gi 118084698 371 TMVDELFAEIVRQMNya 387
3BRW_D       152 INVNEIFYDLVRQINR- 167
1XTQ_A       154 QTAVDVFRRIILEAEKl 170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap