2QYP


Conserved Protein Domain Family
SapB_1

?
pfam05184: SapB_1 (this model, PSSM-Id:191220 is obsolete and has been replaced by 336044)
Click on image for an interactive view with Cn3D
Saposin-like type B, region 1
Statistics
?
PSSM-Id: 191220
View PSSM: pfam05184
Aligned: 162 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
2QYP_A        5 DVYCEVCEFLVKEVTKLI-D-NNKTEKEILDAFDKMCSKLP 43
gi 82255412 198 ADVCQDCVTFLTDAQAQA-KaNSTFLDGFIENIENQCDLLG 237
gi 2498767   21 AILCNLCKDTVKLVENLL---TVDGAQAVRQYIDNLCGKAS 58
gi 74796191  24 KIVCNLCKDLIITLENLL---TSKGADKVKEYIDNLCGKVS 61
gi 74851553 208 VNTCEICNLVSNLIEKYI-K-INNEVDEIRELIENECELLS 246
gi 74850707  74 GTKCDICKFGINQVQKMI-A-SKQGIEDISKYAIDLCTYLH 112
gi 74821949 199 LIPCPACLMAMELVEQEI-S-QSSVQSFVEDKLKNVCAKSP 237
gi 74799453 106 TFNCDECHTISNLIQKRF---RSTDRDSVLESILQICGKMS 143
gi 74854293 128 GTDCEICTFITKYAENLL-E-ANKTIEDIVKVVDDFCKVLP 166
gi 75018917  32 KMFCELCQDGFSLIHKNIeQfESVTNEEIVKFIDHICQLAP 72
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap