Conserved Protein Domain Family
CobD_Cbib

?
pfam03186: CobD_Cbib (this model, PSSM-Id:190556 is obsolete and has been replaced by 308683)
CobD/Cbib protein
This family includes CobD proteins from a number of bacteria, in Salmonella this protein is called Cbib. Salmonella CobD is a different protein. This protein is involved in cobalamin biosynthesis and is probably an enzyme responsible for the conversion of adenosylcobyric acid to adenosylcobinamide or adenosylcobinamide phosphate.
Statistics
?
PSSM-Id: 190556
View PSSM: pfam03186
Aligned: 164 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 4-Apr-2011
Updated: 12-Apr-2011
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam03186 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123583014   5 VWLVLAAFLLDLAFGDPRWLPHPVRAMGSLAAALEaRLRR--TAL---PLRFQGILAAASVIAISSGAAWAVIRGAaaLH 79
gi 123630715  14 VLILMVVLIIKSLVSHFIAH-EPLRFFQFYCLQLGnKVNN--SKNgtqHQTIAGLLALLVTLVPIVIILWLFADFI---- 86
gi 157374253  19 AMILIISLLLSKIAPLPRDY-QPIVWFGLLAKELAaKVNH--TSRapsQQLIAGTLACILLVLPFSAIMTFLMQLA---- 91
gi 119773991  21 FLIILCALPLARLAPLPREM-QPLVWFGVLARELArKVNH--PSRgprQQLIAGIMATILLVLPFWLIIAFLLDLA---- 93
gi 149190322  14 LLVMWSALLFHLLIPIP-SAAHPVRFWQQIAALVAgKVNS--PSStneQQRLAGWLALLLMLVPTSLVLWALEPLV--WK 88
gi 157960828  19 ALVLLVSILLARIAPLPRSL-QPLEWLSQLAKNLSaKANHvdRAPs--QQLIAGTLAMMLLIIPFWAVISFLVELA--E- 92
gi 127511959  18 ASILLVAIFMALLAPLPREY-QAFYWFSQLARSLSaKVAR--ADRsanQQRVAGSLSVLLLVLPFWLILSFLLELA---- 90
gi 88860275   12 LIILLVAICAERFLPLAKSY-HPLTLYQLIIQNIRtRIYQ--ANNptwYQYLAGTLGAVLPAALVLALCFGIISFA---- 84
gi 119472226  12 FIVFIIALLAERFLPL-VSWYHPNTVLVAVFSAIGkRIYN--KQNt--NSYHY--LAAILASALVLSVVLLIVTLL--LE 82
gi 149910449  13 VFILLTAIIIARLPLCPPHF-HPTQLLNYLFSAIAdKVNN--AQRspqQQYIAGHLAMITMLGFILIIAAVIQFIV--IE 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123583014  80 PLFAD-VVSVLIMYSCFATRDLADHALAVLSP-LAAGRLK--EARQRVSWMVGRDTEVMDEDAIALAATESVAENTVDGV 155
gi 123630715  87 -AVDY-LWQGLLLYLALGSLNLGQVNIGIAQA-LVAKKNY--LAKQTLKPLLLRETDQLSSVGLSKAAIEMHLLRSLQQI 161
gi 157374253  92 -AFPW-FFEFIVLYICLNDENFKQTAVEVKQA-LYHEEKN--RARSILSPWLYRDTKELSEVGIAKATIEKLVTTPVYGT 166
gi 119773991  94 -AFPW-FFEFLILYLCLSDASFAQVAEEVQRA-LGHGDKD--RARKLLRQYLSRDTAELSEAGLAKATIEKLVTAPIYGT 168
gi 149190322  89 PEFY----QLALLLLAIDWRNNEQYAHKLINA-LAQEDKA--NARRLLSTKVNRETNNLSLLGIGKAGSETLLLSYARNV 161
gi 157960828  93 --FPW-FFETIIIYLCLQDDHFRYIANEVSIA-IKRDNKI--RARSLLAPWLTRSTTSLSNVGLCKATIERLSTTSIYGT 166
gi 127511959  91 -AFPW-FFECLFLYLCLCDEQFHKVAEETGQA-LARQDKQ--RARRLLSQWVYRDTRELSEVGMSKTVIEKLMTTSIYGT 165
gi 88860275   85 -HYPQ-WFAGLILYISLDFQPLKQSLAKIPSL-LMHNQKS--TARDILKPWLRRQTDTLSSLGIIKASIETLTLRFARHY 159
gi 119472226  83 FAFYPeLLAGLILYLCLESQSLNKKALRIAKL-TKQNQKS--AARELLKPLLAREVSKLSTTGIIKALIESLILRTARYY 159
gi 149910449  88 ---AI-IFELVLLLCLLQW-------EKVSLPeIDLGDLEkqTIISQIQPRTLRDLDQLSLLGLHKASIENMCLRNSYQW 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123583014 156 TAPIFYaLLLGPLGVVAYKAASTLDSTFGYRNERYMEFGWASARFDDLVNFIPARLTVFAIALAAavaklrvfDIFRAVR 235
gi 123630715 162 YVVSFLfIIVGPLAALSYRLMLEMHYCWNTKLGRYKHFGFYSQLFIQLIQWLPSRLMALLILLSTvg-----qGSLLFWR 236
gi 157374253 167 VSTIIFfGIGGAPLVLITRMLKQLELCWPPINPKFAHFGKPVYLLSTLLFIVPSWLWNISIAIQGgp-----kSILSLFK 241
gi 119773991 169 AGVVFFyALAGAPMVLLVRMLKQLELVWPPMSPDFRAFVAPVNLLVSALLYIPAWLWSLTLAIVGg------pSGFKALL 242
gi 149190322 162 VGVLFWyGVSGGVGALLYRLTLELARNWSPSQKGFASFGKPIAWLFSLLDFAPQKLFSILM-FAGlp-----iTSIKHAI 235
gi 157960828 167 VSAILFyAIGGVPLLIVARMIKQLESCWPVYNPEFRVFGMPAYALSTLFHFLPAKLWNLSLAIQGgp-----kSLATLFF 241
gi 127511959 166 VATILFfAVGGAPLVLGARMVKQLEYTWPALNPQYREFGRPVYLLSSLLYWLPTQAWNFTLAIQGgp-----gAVVQLLR 240
gi 88860275  160 FVIVFLyLFFGAYVALGYRLLQITRQTWSKKTPINSPLLRPVDTLIYLIEFVPIRLLCLSLILRKai-----aTPWQNIK 234
gi 119472226 160 FVVIFVfLLLGPVAALGYRLLTLMQQAWRGDISPNSEFLRPLKLVLFVIEYIPVRLLTLTIAASKat-----kQSVHYIK 234
gi 149910449 157 FAVIFWyVSLGIWPAIIYRTIQLMAHNWNSKLPINHQFGRPAASLLQLLASPAHLILACTLRGLQra-----tSPLSNLT 231
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 123583014 236 EGAALHESPNAGYPESAFAGALGVMFGGERSYGGVPDMAPVLGVRAERCNARTLRGAIGLMRLTA 300
gi 123630715 237 LTRGHLFKLNNNFFIAVHAFSLTVRLGGVAMYQGEKLRKAAFNDLGKQPEPRDIINASRKVNFTI 301
gi 157374253 242 PLPNTQPFHNCINTCDIAARVLNIELGGPMKFNGMKIDTTKLSYGPK-PDAQSITSAIRLANTTy 305
gi 119773991 243 TPRRWQPLSNPMRAAYVAATVLNTELGGPHKYRGNRVAVDKVGKG-PLPDTAKIGEAIKLSNRAC 306
gi 149190322 236 MQAKSWHNPVTAWLISGCAHRFELALGGPAIYQGEKLQRARIG-GKVAPSAYHLALLQKHIAWri 299
gi 157960828 242 PKIHATPL-NEYQTCEVIACALSIELGGPVKFNQTRVDMPKLSYGA-LPDQQSLLKAIKLNSVAf 304
gi 127511959 241 PTKSPLPINNHLATCALAAKVLNTELGGPQKFAGQRVDIARIGTGPK-PTPHTITAALRLLRLSk 304
gi 88860275  235 KYGQFYYDKNSGWLLSAMSSTLQIQLGGPALYQKRRYAKMRISQ-HSLPQVTDLILSFNVINQVr 298
gi 119472226 235 HYGQHFYQTNTGWLLSACSASLGVQLGGPAMYFNKRHNKMRVGT-DRLPNADDVPAVLNRLNQAr 298
gi 149910449 232 KQAKQWHHFSSGFLLSSFAYSLAIQLGGPRKYQGTMQRFSQLGH-TEAAQRGDIKRAQQKLTLAL 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap