2YTU,1SXE


Conserved Protein Domain Family
SAM_PNT-ERG_FLI-1

?
cd08531: SAM_PNT-ERG_FLI-1 
Click on image for an interactive view with Cn3D
Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors
SAM Pointed domain of ERG/FLI-1 subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. The ERG and FLI regulators are involved in endothelial cell differentiation, bone morphogenesis and neural crest development. They are proto-oncogenes implicated in cancer development such as myeloid leukemia, Ewing's sarcoma and erythroleukemia. Members of this subfamily are potential targets for cancer therapy.
Statistics
?
PSSM-Id: 188877
Aligned: 7 rows
Threshold Bit Score: 137.542
Threshold Setting Gi: 221108632
Created: 28-Jan-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YTU_A        34 VPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQnMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLL 108 human
1SXE_A        23 VPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQnIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP 97  human
NP_999833    105 VPADPNMWTAEHVQQWVQWAVREYSLVDVQVSRFN-MDGKHLCKMTRDDFSRLTNNLNVDVLISHLTFLKQGYTP 178 purple urchin
NP_001071942 345 VPADPLVWTEEHVQEWVEWTITEYNLSDVDRSSFSnINGRALCEMTKEHFHRITSAKNADVFMSHLNYLRRHTGP 419 Ciona intestinalis
XP_002610129  63 GAFDPMMWSPEHVRQWLHWAIKEYNLQGVEPARFD-MDGKELCRLQRDDFVRLTNVHNGDVLFAHLLFLRQTPLP 136 Florida lancelet
ABR10071      96 VPADPLCWTKEHVRQWILWAIKEFSLKDIDIDRFN-IDGRDLCRLTRDDFMKLAPAYNGDILMAHLCVLRKTPLP 169 starlet sea anemone
XP_002170865   1 MPIEPQLWTREQVRYWVHWAVEEFSLKDISVNAFDmFDGKALCRLTREEFLHYSSAYGGDILISYLCRLYYNSMI 75  green hydra
1SXE_A        23 VPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQnIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP 97  human
NP_999833    105 VPADPNMWTAEHVQQWVQWAVREYSLVDVQVSRFN-MDGKHLCKMTRDDFSRLTNNLNVDVLISHLTFLKQGYTP 178 purple urchin
NP_001071942 345 VPADPLVWTEEHVQEWVEWTITEYNLSDVDRSSFSnINGRALCEMTKEHFHRITSAKNADVFMSHLNYLRRHTGP 419 Ciona intestinalis
XP_002610129  63 GAFDPMMWSPEHVRQWLHWAIKEYNLQGVEPARFD-MDGKELCRLQRDDFVRLTNVHNGDVLFAHLLFLRQTPLP 136 Florida lancelet
ABR10071      96 VPADPLCWTKEHVRQWILWAIKEFSLKDIDIDRFN-IDGRDLCRLTRDDFMKLAPAYNGDILMAHLCVLRKTPLP 169 starlet sea anemone
XP_002170865   1 MPIEPQLWTREQVRYWVHWAVEEFSLKDISVNAFDmFDGKALCRLTREEFLHYSSAYGGDILISYLCRLYYNSMI 75  green hydra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap