Conserved Protein Domain Family
PTZ00488

?
PTZ00488: PTZ00488 
Proteasome subunit beta type-5; Provisional
Statistics
?
PSSM-Id: 185666
View PSSM: PTZ00488
Aligned: 2 rows
Threshold Bit Score: 518.39
Threshold Setting Gi: 167521858
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167521858   1 MICGPERPPHSPGLHPVNFLAPyTNTNGDGNVKIHIAHGTTTLGFKYQGGVIIAVDSRATAGSYIASQTVKKVIEINPYL 80 
66800081   25 KFLNTPHFELPPNANPGDFLRE-TFDHPSAPKALEFAHGTTTLAFVYGGGIIVSVDSKSTQGPYVASRSVKKVIEITPTL 103
167521858  81 LGTMAGGAADCSYWERYLAMQCRLYELRNGERISVAAASKVLANIVWNYRNMGLSMGTMVCGWDKKGPGLFYVDSDGTRL 160
66800081  104 LGTMAGGAADCSFWERELGRRCRLYELRNKELISVAAASKILANIVYSYKGYGLSMGTMITGWDKTGPQLYYVDNDGTRL 183
167521858 161 TNNMFSVGSGSTYAYGVLDAGYKWDLSDEEAQDLGRRAIYHATFRDAYSGGTVNLYHMRQTGWVKISADSVHDLHYRYAA 240
66800081  184 HGQRFSCGSGSTYAYGVLDTGFKWDMNDEEAYELGRRAVYHATHRDAYSGGAINVYHVQKDGWKKISSDDCFKLYQKYYN 263
167521858 241 EKETSTA 247
66800081  264 IVPINKP 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap