Conserved Protein Domain Family
PTZ00184

?
PTZ00184: PTZ00184 
calmodulin; Provisional
Links
?
Statistics
?
PSSM-Id: 185504
View PSSM: PTZ00184
Aligned: 40 rows
Threshold Bit Score: 233.115
Threshold Setting Gi: 145499568
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PTZ00184 is a member of the superfamily cl25352.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71031284    1 MADQLSEEQIAEFKEAFALFDKDGDGSITSKELGTIMRSLGQNPTEAELQDMINEIDANSNGSIDFPEFLTLMARKMKEC 80
gi 124809127   1 MADKLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFPEFLTLMARKLKDT 80
gi 84994554    1 MADQLSEEQIAEFKEAFSLFDKDGDGSITTKELGTIMRSLGQNPTEAELQDMINEIDTNSSGAIDFPEFLILMARKMKEC 80
gi 156101878   1 MADKLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFPEFLTLMARKMKDT 80
gi 156083146   1 MADQLSEEQIAEFKEAFSLFDRDGDGSITTKELGTVMRSLGQNPTEAELADMINDIDTSGTGAIDFPEFLILMARKMKEG 80
gi 159111176   5 MPINLPQETLEEFKEAFNLFDRNGDGNITTAELGTVMRSLGQNPTEADLADMINSIDTDGNGVISFVEFVRLMVTKSRNT 84
gi 221060050   1 MADKLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFPEFLTLMARKMKDT 80
gi 237835921   1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTLMARKMKDT 80
gi 290987824   1 MVDRLTDEQIQEYKEAFSLFDSDSDGTIVTKELGTVMRALGLNPSQGELDDMIKQVDSNNNGTIDFKEFLVLMQKKMTDN 80
gi 294948080   1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKDT 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 71031284   81 DTEEELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDEEVDEMLREADVDGDGKINYEEFVKLMVSK 149
gi 124809127  81 DTEEELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEMIREADIDGDGQINYEEFVKMMIAK 149
gi 84994554   81 DTEEELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDEEVDEMLREADVDGDGKINYEEFVKLMVSK 149
gi 156101878  81 DTEEELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEMIREADIDGDGQINYEEFVKMMIAK 149
gi 156083146  81 DTEEELVQAFKVFDRDGNGFISAQELRHVMTNLGEKLTNEEVEEMLREADVDGDGKINYEEFVKLMISK 149
gi 159111176  85 DSEEELREAFRVFDRNGDGYVNAAELRHVLTHIGEKLDEDEVDDLLREADIDGEGQIKYADFVKILCRR 153
gi 221060050  81 DTEEELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEMIREADIDGDGQINYEEFVKMMIAK 149
gi 237835921  81 DTEEELIEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMAK 149
gi 290987824  81 DSEDEIKEAFKVFDRDNDGIISAAELRHILTSMGEKFNEEEAEDFIREADTNGDGQIKYEDFCRLMMSN 149
gi 294948080  81 DTEEELIEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVRMMMAK 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap