Conserved Protein Domain Family
PTZ00168

?
PTZ00168: PTZ00168 
mitochondrial carrier protein; Provisional
Statistics
?
PSSM-Id: 185494
View PSSM: PTZ00168
Aligned: 3 rows
Threshold Bit Score: 482.887
Threshold Setting Gi: 124806705
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156095815   1 MEHFHNLVTGALSGVAVDAVLYPIDSLKTNMQAKKALSFSDIKKMYSGIFPTLVGTIPASAFFYCFYELSKKLLKEKREN 80 
221061835   1 MEHFHNFVTGALSGVTVDAVLYPIDSIKTNAQAKKSFSFSDIKKLYSGILPTLVGTVPASAFFYCFYELSKKLLTENREN 80 
124806705   1 MEHLKNLITGAISGAIVDAVLFPIDYIKTNIQTNNSFSIYDPRKLYNGILPTLIGTVPASAFFYCFYELSKKLLTDYNAN 80 
156095815  81 ISKTNLYLISTSMAEVAASVVRMPFEIVKQKMQVSGSSSVINTIYEITQREGLLSFLGKSYFVIIVREIPFDCIQYFLWE 160
221061835  81 ISKTNLYLISTSVAEITACTVRVPFEIVKQRMQVSGNTSVLRTIYEVTQREGLMSFLGKSYFVMIVREIPFDCIQYFLWE 160
124806705  81 INKSSLYLISTSIAEITACIIRLPFEILKQNMQVSGNISTLKAIYNISKKNDLPIYLLNSYLIMVAREIPFDCIQYFLWE 160
156095815 161 TLKEKAKRDFGKFSKKYPSITSAICGGLAGGIAGFLTTPMDVIKSRQIIYGKSYIETVTEIAEEGYLTFYKGCCFRSIYL 240
221061835 161 TLKEKAKKDFGKFSKKYPSITSAICGGLAGGIAGFLTTPLDVIKSRQIIYGKSYIETVTEIAEEGYMTFYRGCCFRSLYL 240
124806705 161 SLKEKGKKDFKNISEIYPTLTSALCGGIAGGISGFLTTPVDVIKSRQIIYGKSYIETIKDISKGGFLSFYKGCYVRASYL 240
156095815 241 FFGGLIFFGSLRFFSFKKE 259
221061835 241 FFGGLIFFGSLRFFSFKKE 259
124806705 241 CFGGMIFFGCLRFFSF--- 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap