Conserved Protein Domain Family
PTZ00018

?
PTZ00018: PTZ00018 
histone H3; Provisional
Statistics
?
PSSM-Id: 185400
View PSSM: PTZ00018
Aligned: 61 rows
Threshold Bit Score: 217.85
Threshold Setting Gi: 237842633
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71028626    1 MARTKQTARKSTGG-KAPRKQLASKAARKTA--PV---TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVRE 74
gi 229595561   1 MARTKQTARKSTGA-KAPRKQLASKAARKSA--PA---TGGIKKPHRFRPGTVALREIRKYQKSTDLLIRKLPFQRLVRD 74
gi 145511027   1 MARTKQTARKSTAGnKKPTKHLATKAARKTA--PAvgaAGGLKKPHKFRPGTVALREIRKYQKSTELLIRKLPFQRLVRE 78
gi 145530748   1 MARTKQTARKSTAGnKKPTKHLATKAARKTA--PAvgpSGGLKKPHKFRPGTVALREIRKYQKSTELLIRKLPFQRLVRD 78
gi 145531098   1 MARTKQTARKSTTGnKKPTKHLATKAARKTA--PAvgaTGGLKKPHKFRPGTVALREIRKYQKSTELLIRKLPFQRLVRE 78
gi 145534710   1 MARTKQTARKSTAGnKKPTKHLATKAARKTA--PAvgaAGGLKKPHKFRPGTVALREIRKYQKSTELLIRKLPFQRLVRE 78
gi 290973722   1 MARTKQTARKSTGG-KAPRKQLASKAARKSAkqPS---TGGLKKPHRYKPGTVALREIRKYQKSTELLIRKLPFQRLVRE 76
gi 290984695   1 MARTKQTARKSTGG-KAPRKQLASKAARKSAkqPS---TGGLKKPHRYKPGTVALREIRKYQKSTELLIRKLPFQRLVRE 76
gi 290999757   1 MARTKQTARKSTGG-KAPRKQLASKAARKSAkqPS---TGGLKKPHRYKPGTVALREIRKYQKSTELLIRKLPFQRLVRE 76
gi 294877992   1 MARIKQTAHKSTGG-KMPRKQLASKAARKSS--PA---VSTIRRPHRFRPGTVALREIRWYQRSSELLIKKLPFQRLIRE 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 71028626   75 VAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDVHLARRLRGERA 136
gi 229595561  75 IAHEFKAELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTIMTKDMQLARRIRGERF 136
gi 145511027  79 IAHEFQKELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTIMSRDIQLARRIRGERF 140
gi 145530748  79 IAHDFQKELRFQSSAILALQEAAEGYLVGLFEDTNLCAIHARRVTIMSRDIQLARRIRGERF 140
gi 145531098  79 IAHEFQKELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTIMSRDIQLARRIRGERF 140
gi 145534710  79 IAHEFQKELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTIMSRDIQLARRIRGERF 140
gi 290973722  77 IAQDYKSDLRFQSNAVLALQEASEAYLVSLFEDTNLCAIHAKRVTIMQKDMQLAKRIRGERT 138
gi 290984695  77 IAQDYKSDLRFQSNAVLALQEASEAYLVSLFEDTNLCAIHAKRVTIMQKDMQLAKRIRGERT 138
gi 290999757  77 IAQDYKSDLRFQSNAVLALQEASEAYLVSLFEDTNLCAIHAKRVTIMQKDMQLAKRIRGERT 138
gi 294877992  75 IAQEFEVGLRFQKSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGE-- 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap