Conserved Protein Domain Family
PRK15374

?
PRK15374: PRK15374 
pathogenicity island 1 effector protein SipB; Provisional
Statistics
?
PSSM-Id: 185272
View PSSM: PRK15374
Aligned: 22 rows
Threshold Bit Score: 687.082
Threshold Setting Gi: 34498074
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PRK15374 is classified as a model that may span more than one domain.
PRK15374 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161502071   1 MVNDTSSVSRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTK-SGETTFNTVGLTPPTDAAREKL 79
gi 74314927    1 --MHNVSTTTTGLSLAKILASTEL-----GDNTIQAANDAANKLFSLTIADLTANKNiNTTNSHSTSNILIPELKAPKSL 73
gi 82524572    1 --MHNVSTTNTGLPLAKILASTEL-----GDNTIQAANDAANKLFSLTIADLTANNNiNTTNAHSTSNILIPELKAPKSL 73
gi 13449074    1 --MHNVSTTTTGFPLAKILTSTEL-----GDNTIQAANDAANKLFSLTIADLTANQNiNTTNAHSTSNILIPELKAPKSL 73
gi 34498074    1 -MSDASAISRSAYLHNPKLAETAFESVRKDGTFLDAADKALKAVLATKAGEADGKAP-IRERDLATPALTQPTAKAKEEL 78
gi 31983588    1 --MHNVSTTTTGFPLAKILASTEL-----GDNTIQAANDAANKLFSLTIADLTANQNiNTTNAHSTSNILIPELKAPKSL 73
gi 207858147   1 MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTK-SGESAINTVGLKPPTDAAREKL 79
gi 205353828   1 MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTK-SGESAINTVGLKPPTDAAREKL 79
gi 198243016   1 MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTK-SGESAINTVGLKPPTDAAREKL 79
gi 194449012   1 MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTK-SGESAINTVGLKPPTDAAREKL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161502071  80 SSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKAMGLQVSKEFQAALGEAEKATDIYEESIKKMDTAKSVYDT 159
gi 74314927   74 NASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKD 153
gi 82524572   74 NASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKD 153
gi 13449074   74 NASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKD 153
gi 34498074   79 DGAGKLTLLLGQLMSLLGNVSLSQLESRIATWRAMMEAQVAMGEKLSQEFQDAFKAASEATEALKDAVGNYDSAKQAADA 158
gi 31983588   74 NASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKD 153
gi 207858147  80 SSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKEMGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDA 159
gi 205353828  80 SSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKEMGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDA 159
gi 198243016  80 SSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKEMGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDA 159
gi 194449012  80 SSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKEMGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDA 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161502071 160 AAKKLTQAQNKLQSMDPSDPG---YAKAEAAEGQARKEAKDAKTAFDKAKKAADLAGTDAKTKTEQADNILTKFQGTTNv 236
gi 74314927  154 LENKINQIQTRLSELDPDSPEkkkLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTAS- 232
gi 82524572  154 LENKINQIQTRLSELAPDSPEkkkLRREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTAS- 232
gi 13449074  154 LENKINQIQTRLSELDPESPEkkkLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTAS- 232
gi 34498074  159 AQKKADAAQAKVDGMSPDEPG---YAEAQAASQQAAADALQAKQKADKAYDAAEKARVVAVEKGKVADDLAGKVQGANV- 234
gi 31983588  154 LENKINQIQTRLSELDPESPEkkkLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTAS- 232
gi 207858147 160 ATKKLTQAQNKLQSLDPADPG---YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTAN- 235
gi 205353828 160 ATKKLTQAQNKLQSLDPADPG---YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTAN- 235
gi 198243016 160 ATKKLTQAQNKLQSLDPADPG---YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTAN- 235
gi 194449012 160 ATKKLTQAQNKLQSLDPADPG---YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTAN- 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161502071 237 VASQTEVAKGEKDNLSNVARLTMLMAMFIEIVGKNNEEGLQNDLALFNALQEGRQAEMEKKSAEFQEETRKAEETNRIMG 316
gi 74314927  233 ----AEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMG 308
gi 82524572  233 ----AEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMG 308
gi 13449074  233 ----AEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMG 308
gi 34498074  235 --NADVARKTGEDNLSNVAKLTLLMAMFVELVGKNSEESLKNDLALFQALQEGRQKEMDKKSAEYQEEVRKAEELNRTMG 312
gi 31983588  233 ----AEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMG 308
gi 207858147 236 AASQNQVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEFQEETRKAEETNRIMG 315
gi 205353828 236 AASQNQVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEFQEETRKAEETNRIMG 315
gi 198243016 236 AASQNQVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEFQEETRKAEETNRIMG 315
gi 194449012 236 AASQNQVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEFQEETRKAEETNRIMG 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161502071 317 CIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAATGVSFIQQALNPIMEHVLKPLMELIGKAITKALEG 396
gi 74314927  309 CVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEG 388
gi 82524572  309 CVGKILGALLTIVSVVAAAFSGGSSLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEG 388
gi 13449074  309 CVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEG 388
gi 34498074  313 CIGKILGALLTVVSVVAAAFTGGASLALAAVGVALMVADEVVKAATGVSFMQEALKPLMDKVLKPLMDLIGKAITKALEG 392
gi 31983588  309 CVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEG 388
gi 207858147 316 CIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAATGVSFIQQALNPIMEHVLKPLMELIGKAITKALEG 395
gi 205353828 316 CIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAATGVSFIQQALNPIMEHVLKPLMELIGKAITKALEG 395
gi 198243016 316 CIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAATGVSFIQQALNPIMEHVLKPLMELIGKAITKALEG 395
gi 194449012 316 CIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAATGVSFIQQALNPIMEHVLKPLMELIGKAITKALEG 395
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161502071 397 LGVDKKTAEMAGSIVGAIVAAIAMVAVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRI 476
gi 74314927  389 LGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARL 468
gi 82524572  389 LGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARL 468
gi 13449074  389 LGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARL 468
gi 34498074  393 MGVDKKTAELAGSIAGAVLAAVAMVVVMVVVAVVGKGAAGKLGGALSKLLGDAIKKIVPNVLKELAKGGSKMLTQGFQRL 472
gi 31983588  389 LGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARL 468
gi 207858147 396 LGVDKKTAEMAGSIVGAIVAAIAMVAVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRI 475
gi 205353828 396 LGIDKKTAEMAGSIVGAIVAAIAMVAVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRI 475
gi 198243016 396 LGVDKKTAEMAGSIVGAIVAAIAMVAVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRI 475
gi 194449012 396 LGVDKKTAEMAGSIVGAIVAAIAMVAVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRI 475
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161502071 477 TSGLGNVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEAIADFTLARFAMDQIQQWLKQS 556
gi 74314927  469 NKFLGAAGDEV------ISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEA 542
gi 82524572  469 NKFLGAAGDEV------ISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNNASTNLADLTLSKYQVEQLSKYISEA 542
gi 13449074  469 NKFLGAAGDEV------ISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEA 542
gi 34498074  473 ANSLG-------LQTDAAAKQMMANTLGRVVVGGEVAQATSQAGGNVAQGVFMKNASDALADFTLARAAMEQIEQWLKQA 545
gi 31983588  469 NKFLGAAGDEV------ISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEA 542
gi 207858147 476 TSGLGNVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFMLARFAMDQIQQWLKQS 555
gi 205353828 476 TSGLGNVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFMLARFAMDQIQQWLKQS 555
gi 198243016 476 TSGLGNVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFMLARFAMDQIQQWLKQS 555
gi 194449012 476 TSGLGNVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFMLARFAMDQIQQWLKQS 555
                        570       580       590
                 ....*....|....*....|....*....|....*...
gi 161502071 557 VEIFGENQKVTAELQKVMSSAVQQNADASRFILRQSRA 594
gi 74314927  543 IEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA 580
gi 82524572  543 IEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA 580
gi 13449074  543 IEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA 580
gi 34498074  546 VEVFASTQKVTQELTTAMSAAVQQNAEAGRFVLRQSHA 583
gi 31983588  543 IEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA 580
gi 207858147 556 VEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA 593
gi 205353828 556 VEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA 593
gi 198243016 556 VEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA 593
gi 194449012 556 VEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA 593
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap