Conserved Protein Domain Family
PRK14514

?
PRK14514: PRK14514 
ATP-dependent Clp protease proteolytic subunit; Provisional
Statistics
?
PSSM-Id: 184722
View PSSM: PRK14514
Aligned: 9 rows
Threshold Bit Score: 417.011
Threshold Setting Gi: 60683331
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188995413   1 MNEFKKYATRHIGLNAQALDDYTRIQSSYISPTIIEERQLNVAQMDVFSRLMMDRIIFLGTQIDDYTANVIQAQLLYLDS 80 
212550900   2 NNDFKNYAIKHLGIDTNLLDKYSTVSNSYISPTIIEERQLNVAQMDVFSRLMMDRIIFLGTRIDDYSASVVQAQLLYLDS 81 
34540241    1 MNEFKKYATRHIGLNAQALDDYTRIQSSYISPTIIEERQLNVAQMDVFSRLMMDRIIFLGTQIDDYTANVIQAQLLYLDS 80 
29349250    1 MDDFRKYATKHLGMNGMVLDDVIKSQAGYLNPYILEERQLNVTQLDVFSRLMMDRIIFLGTQVDDYTANTLQAQLLYLDS 80 
60683331    1 -------------MNAMVLDDVIKSQAGYLNPYILEERQLNVTQLDVFSRLMMDRIIFLGTQIDDYTANTLQAQLLYLDS 67 
53715362    1 MDDFRKYATKHLGMNAMVLDDVIKSQAGYLNPYILEERQLNVTQLDVFSRLMMDRIIFLGTQIDDYTANTLQAQLLYLDS 80 
150009000   1 MEDFRKYATKHLGMSGTALDSYMNISSSYISPTIIEERQLNVAQMDVFSRLMMDRIIFLGTQVDDYTANVIQAQLLYLDS 80 
150003037   1 MDDFRKFATKHLGMNSMVLDDVIKSQ-GYLNPYILEERQLNVTQLDVFSRLMMDRIIFLGTQIDDYTANTLQAQLLYLDS 79 
302345891   1 MNDFRRYATGHLGMNGMVLDDVMRAQAQYLNPYILEERQLNVTQMDVFSRLMMERIIFLGTQVDDYSANTIQAQLLYLDS 80 
188995413  81 ADPGKDISIYLNSPGGSVYAGYGIYDTMQYIGCDVATICTGMAASMASVLLVAGTKGKRFALPHSRVMIHQPLGGMQGQA 160
212550900  82 AEPGKDISIYINSPGGTVYAGYGIYDTMQFISSDVTTICTGMAASMAAVLLVAGTKGKRSALCHSRVMIHQPLGGAQGQA 161
34540241   81 ADPGKDISIYLNSPGGSVYAGYGIYDTMQYIGCDVATICTGMAASMASVLLVAGTKGKRFALPHSRVMIHQPLGGMQGQA 160
29349250   81 VDPGKDISIYINSPGGSVYAGLGIYDTMQFISSDVATICTGMAASMAAVLLVAGAEGKRSALPHSRVMIHQPMGGAQGQA 160
60683331   68 VDPGKDISIYINSPGGSVYAGLGIYDTMQFISSDVATICTGMAASMASVLLVAGAKGKRSALPHSRVMIHQPMGGAQGQA 147
53715362   81 VDPGKDISIYINSPGGSVYAGLGIYDTMQFISSDVATICTGMAASMASVLLVAGAKGKRSALPHSRVMIHQPMGGAQGQA 160
150009000  81 SDPGKDISIYINSPGGSVYAGYGIYDTMQFISSDVSTICTGMAASMASVLLVAGTKGKRFGLKHSRVMIHQPLGGVQGQA 160
150003037  80 VESGKDISIYINSPGGSVYAGLGIYDTMQFINSDVATICTGMAASMAAVLLVAGTEGKRSALTHSRVMIHQPMGGAQGQA 159
302345891  81 VDPGKDISIYINSPGGSVTAGLGIYDTMQFISSDVATLCTGMAASMAAVLLVAGKEGKRSALKHSRVMIHQPLGGVQGQA 160
188995413 161 SDLEIAAREILRVKKELYTIISSHSGKPVKQVEKDSDRDYWMTAPEALEYGMIDKILEKNR 221
212550900 162 SDIEITAREILKIKKEIYTIIAEHSGQSYEQVLKDGDRDFWMNAEEALAYGMIDGILTKKK 222
34540241  161 SDLEIAAREILRVKKELYTIISSHSGKPVEQVEKDSDRDYWMTAPEALEYGMIDKILEKNR 221
29349250  161 SDIEITAREIQKLKKELYTIIADHSHTDFDKVWADSDRDYWMTAQEAKEYGMIDEVLIKK- 220
60683331  148 SDIEITAREIQKLKKELYTIIADHSGTSFDKVWADSDRDYWMTAQEAKEYGMIDEVLIKK- 207
53715362  161 SDIEITAREIQKLKKELYTIIADHSGTSFDKVWADSDRDYWMTAQEAKEYGMIDEVLIKK- 220
150009000 161 SDIEITAREILKVKKELYTIISDHSGRPYEEIERDGDRDFWMTAEEAKKYGMIDDVLTRK- 220
150003037 160 SDIEITAREIQKLKKELYTIIADHSHTDFDKVWADSDRDYWMTAQEAKEYGMIDEVLSRKP 220
302345891 161 SDIEIEAREIQKFKKELYNIISEHSHQPFDKVWNDSDRNYWMTSEEAKEYGMIDEVLMRKP 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap