Conserved Protein Domain Family
PRK14235

?
PRK14235: PRK14235 (this model, PSSM-Id:184581 is obsolete and has been replaced by 237645)
phosphate transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 184581
View PSSM: PRK14235
Aligned: 58 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89054783    3 DMSMSNPTESAAVTDMKMQARGVDVFYGAgasarsaddmaadksvTHAIKEVDVDIADKTVTAFIGPSGCGKSTFLRVLN 82
gi 103486313   1 -----MTNDDLTITDPKMRAQGVNVFYGD----------------KQAINNVSIDVGTDLVTAFIGPSGCGKSTFLRSLN 59
gi 85373909    1 ---------MEHPGAPKMRTKDVSVYYGD----------------KKAIDQVTIDIPAEYVTAFIGPSGCGKSTFLRTLN 55
gi 87200293   11 TVDVKADDKPYFDAPSKMSAKNVSVFYGD----------------KRAIDDVSIEIPQRYVTAFIGPSGCGKSTFLRSLN 74
gi 16124547   10 TRAPATSTAAPATADPKIKARGVKVFYGD----------------KQALFDVDLDIPAKSVTAFIGPSGCGKSTFLRCIN 73
gi 159044085   1 -MNDMRLTERAVTEQTKIAAKNVQVYYGT----------------THAIKDVNVDILDKTVTAFIGPSGCGKSTFLRCLN 63
gi 221233233  27 TRAPATSTAAPATADPKIKARGVKVFYGD----------------KQALFDVDLDIPAKSVTAFIGPSGCGKSTFLRCIN 90
gi 294012875   6 TAMMHEQQTLAPAAEPKMTARDVRVFYGD----------------KQAIKGVSIDVDMDNVTAFIGPSGCGKSTFLRTLN 69
gi 294679016   1 MNNMRLTERAVTTDVTKFTARKVQVYYGA----------------SHAIKDVDIDILDKTVTAFIGPSGCGKSTFLRCLN 64
gi 295691209  33 QTAVPPASAAAPVGEPKIKARDVKVFYGD----------------KQALFDVNIDIPAKSVTAFIGPSGCGKSTFLRCIN 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89054783   83 RMNDTIDGCRMTGKVTLEGEDIYDPKVDPVQLRAKVGMVFQKPNPFPKSIFDNVAYGPRIHGLARNKADLSDIVEKSLRR 162
gi 103486313  60 RMNDTVASAKVTGKIELDGEDIYAPSMDVVQLRARVGMVFQKPNPFPKSIYDNVGYGPRIHGLAPSKADLDVVVERALVR 139
gi 85373909   56 RMNDTIPSARVEGTIELDGDDVYASSMDVVQLRARVGMVFQKPNPFPKSIYDNVAYGPSIHGLAPTKADLDQIVEKSLQR 135
gi 87200293   75 RMNDTIANARVEGEILLDGEDIYKSGMDVVQLRARVGMVFQKPNPFPKSIYENIAYGPKIHGITGSKAELDEIVEQSLRR 154
gi 16124547   74 RMNDTIPSARVEGSILIDGADVNAKSVDPVVLRSRVGMVFQKPNPFPKTIFENVAYGPRIHGLATGKAELEAIVESSLKK 153
gi 159044085  64 RMNDTIDTARIEGDIRIDGEDIYDRRVDPVQLRAKVGMVFQKPNPFPKSIYDNVAYGPRIHGLARTRAELDEIVEKSLRR 143
gi 221233233  91 RMNDTIPSARVEGSILIDGADVNAKSVDPVVLRSRVGMVFQKPNPFPKTIFENVAYGPRIHGLATGKAELEAIVESSLKK 170
gi 294012875  70 RMNDTVASARVEGAITLDGEDIYAPSMDVVQLRARVGMVFQKPNPFPKSIYENIAYGPRIHGLAHAKADLDVIVEKSLRR 149
gi 294679016  65 RMNDTIDICRVEGAIQLDGEDIYDKKVDPVQLRARVGMVFQKPNPFPKSIYDNVAYGPKIHGLVRNKAELDEVVESALRK 144
gi 295691209  97 RMNDTIPSARVEGSIEIDGADVNARSVDPVVLRSRVGMVFQKPNPFPKTIFENVAYGPRIHGLATGKVELEAIVESSLKK 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89054783  163 AAIWEEVKDRLDAPGTGLSGGQQQRLCIARAVATSPEVLLMDEPCSALDPIATAQVEELIDELRTRFSVVIVTHSMQQAA 242
gi 103486313 140 AGLWDEVKDRLNESGTALSGGQQQRLCIARAIAVDPEVILMDEPCSALDPIATAKIEELIHELRGKYAIVIVTHNMQQAA 219
gi 85373909  136 AGLWNEVKDRLQESGTALSGGQQQRLCIARAIAVDPEVILMDEPCSALDPIATAKIEELIDELQGRYAIVIVTHSMQQAA 215
gi 87200293  155 AGLWDEVKDRLGDSGTALSGGQQQRLCIARAIAVDPEVILMDEPCSALDPIATARIEELIDELRGRYAIVIVTHSMQQAA 234
gi 16124547  154 AGLWNEVADRLHQPGTGLSGGQQQRLVIARAIAVSPEVILMDEPCSALDPIATAKIEELIDELRSQFCIVIVTHSMAQAA 233
gi 159044085 144 AALWDEAKDRLDQPGTGLSGGQQQRLCIARAVATSPEVLLMDEPCSALDPIATAQVEELIDELRERYSVVIVTHSMQQAA 223
gi 221233233 171 AGLWNEVADRLHQPGTGLSGGQQQRLVIARAIAVSPEVILMDEPCSALDPIATAKIEELIDELRSQFCIVIVTHSMAQAA 250
gi 294012875 150 AGLWDEVKDRLHDSGTALSGGQQQRLCIGRAIAVEPEVILMDEPCSALDPIATAKIEELIHELRGRYAIVIVTHNMQQAA 229
gi 294679016 145 AALWNEVKDRLTAPGTGLSGGQQQRLCIARAVATSPEVLLMDEPCSALDPIATAQVEELIDELRSNFSVVIVTHSMQQAA 224
gi 295691209 177 AGLWNEVADRLHQPGTGLSGGQQQRLVIARAIAVSPEVILMDEPCSALDPIATAKIEELIDELRSQFCIVIVTHSMAQAA 256
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 89054783  243 RVSQKTAFFHLGNLVEFDETDKIFTNPSDPRTESYITGRIG 283
gi 103486313 220 RVSQRTAFFHLGTLVEYGKTTDIFTNPKQERTKDYITGRYG 260
gi 85373909  216 RVSQRTAFFHLGEMVEYGPTDAIFTTPQEERTKDYITGRYG 256
gi 87200293  235 RVSQRTAFFHLGKIVEYGKTSDIFTNPREERTKDYITGRYG 275
gi 16124547  234 RVSQRTAFFHLGKLVESGPTEEMFTNPRDSRTQDYITGRFG 274
gi 159044085 224 RVSQRTAFFHLGHLVEYGETGHIFTNPEDPRTESYITGRIG 264
gi 221233233 251 RVSQRTAFFHLGKLVESGPTEEMFTNPRDSRTQDYITGRFG 291
gi 294012875 230 RVSQRTAFFHLGELVEYGVTSDIFTNPKQERTKDYITGRYG 270
gi 294679016 225 RVSQRTAFFHLGNLVEFGETGQIFTNPRDPRTESYITGRIG 265
gi 295691209 257 RVSQRTAFFHLGKLVESGPTEEMFTNPRDSRTQDYITGRFG 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap