Conserved Protein Domain Family
PRK13633

?
PRK13633: PRK13633 (this model, PSSM-Id:184193 is obsolete and has been replaced by 237453)
cobalt transporter ATP-binding subunit; Provisional
Statistics
?
PSSM-Id: 184193
View PSSM: PRK13633
Aligned: 25 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 153938212   1 MNEMIKCNNVTYKYESNKEdesTQKIALDKVNLTIKKGDFVVILGRNGSGKSTIAKHMNSLLIPSEGKVYVDNLDTENLE 80
gi 20808630   17 MAFIIRAQNVSFCYSEGES---KSPPVLKDINLQFEKGQFIGIIGHNGSGKSTLAKHFNALLLPTKGNVYVKDMDTKDAK 93
gi 167039550   1 MEHVITTQNLFFEYHAEEQ---TRHLVLKDINLQFEKGQFIGIIGHNGSGKSTLAKHFNALLLPTEGKVYVKGMDTKDTN 77
gi 167036831   1 MEHVINTQNLSFEYHAEEQ---TRHLVLKDINLQFEKGQFIGIIGHNGSGKSTLAKHFNALLLPTEGKVYVKGMDTKDTN 77
gi 15896353    2 YNKMVECKNVVYQYKNEDEs--KNTTAVNDVTLEVNEGEFLVILGRNGSGKSTLAKHLNALLVPTDGKVIVEGLDTSNEE 79
gi 150015074   2 SDAMIKCAKVSFKYVKDTEgvkQEKYAIKDVDLEVKKGEFLVVLGHNGSGKSTIAKHMNALVVPSEGTVIVDGLDTSKME 81
gi 187935419   2 NQEMVNCTDVCFKYIRNEEgarEEKYALKNVNLKVKKGEFLVVLGHNGSGKSTIAKHMNALLMPSSGTVIVDNLSTSEEN 81
gi 188587979   2 NQEMVNCTDVSFKYIRNEEgatEEKYALKNVNLKVKKGEFLVVLGHNGSGKSTIAKHMNALLSPSSGTVIVDSLNTSDEN 81
gi 289579112   1 MEHIITTQNLSFEYHTEEQ---TRHLVLKDINLQFKKGQFIGIIGHNGSGKSTLAKHFNALLVPTEGKVYVKGMDTKDAK 77
gi 302876503   2 KDIMIDCKNLFYAYADDGEt--VSTYAVNDVSLEVRRGEFVAILGRNGSGKSTISKQFNGLFTPSSGKVYVDGFDTSLEG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 153938212  81 NTWDIRNKAGMVFQNPDNQIVATIVEEDVAFGPENLGIPQEEIRSRVDESLKKVNMYDYRRHAPHLLSGGQKQRVAIAGV 160
gi 20808630   94 HLWDIRQTAGLVFQNPDNQIVAAIVEEDVAFGPENLGIPPEEIRKRVEYALKAVGMWEYKDFPPHMLSGGQKQRVAIAGI 173
gi 167039550  78 HLWDIRQAAGLVFQNPDNQIVAAIVEEDVAFGPENLGIPPDEIRERVEYALKAVGMWEYKDYPPHMLSGGQKQRVAIAGI 157
gi 167036831  78 HLWDIRQAAGLVFQNPDNQIVAAIVEEDVAFGPENLGIPPDEIRERVEYALKAVGMWEYKDYPPHMLSGGQKQRVAIAGI 157
gi 15896353   80 DVWTIRSKTGMVFQNPDNQIVATIVEEDVAFGPENLGVKPSEIRERVDNALKSVGMYEYRKHEPHLLSGGQKQRVAIAGV 159
gi 150015074  82 NVWEIRSRAGMVFQNPDNQLVATIVEEDVAFGPENLGIEPLEIRKRVDESLEKVGMSKYKRHAPHLLSGGQKQRIAIAGI 161
gi 187935419  82 NLWEIRSRAGMVFQNPDNQLVATIVEEDVAFGPENLGVEAKEIRKRVDESLEKVGMSEYKRHAPHLLSGGQKQRIAIAGI 161
gi 188587979  82 NLWEIRSRAGMVFQNPDNQLVATIVEEDVAFGPENLGVESKEIRKRVDDSLEKVGMSEYKRHAPHLLSGGQKQRIAIAGI 161
gi 289579112  78 HLWDIRQTAGLVFQNPDNQIVAAIVEEDVAFGPENLGISPDEIKERVEYALKAVGMWEYKDYPPHMLSGGQKQRVAIAGI 157
gi 302876503  80 NVWDIRKSCGMIFQNPDNQIVATIVEEDVAFGPENLGIQPEEIRTRVDEALKKVDMFEFRKHAPHLLSGGQKQRVAIAGI 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 153938212 161 LAMRPECIIFDEPTAMLDPSGRLEVVNTIKEINKKYGITIVLITHFMEEAVEADKVIVMDSAKVIKEGTPKEIFKEVEMM 240
gi 20808630  174 IAMKPECIVLDEPTAMLDPIGRREVISTIKKLNKEEGITVILITHFMEEVVDADRVIVMDDGKVVLDGTPKEVFKEVEVL 253
gi 167039550 158 IAMKPECIILDEPTAMLDPIGRREVISTIKKLNKEDGITVILITHFMEEVVDADRVIVMDDGKVVLDGTPKEVFKEVTLL 237
gi 167036831 158 IAMKPECIILDEPTAMLDPIGRREVISTIKKLNKEDGITVILITHFMEEVVDADRVIVMDDGKVVLDGTPKEVFKEVTLL 237
gi 15896353  160 LAMHPKCIVFDESTAMLDPKGREEVVNTIMDLNKNSHITIILITHYMEEAINADRIVVMDKGKVIKSGVPREVFKDVKTM 239
gi 150015074 162 LAIQPECIIFDEPTAMLDPSGRREVLKTINELNKIHGITIVLITHYMDEAAQADRIVVMDGGSVKMEGTPREIFPQVERM 241
gi 187935419 162 LAIQPKCIIFDEPTAMLDPSGRKDVLKTIKDINKNYGITIVLITHYMDEAAQADRIVVMDGGEVKMEGTPKEIFPQVEMM 241
gi 188587979 162 LAIQPKCIIFDEPTAMLDPSGRKDVLKTIKDINKNYGITIVLITHYMDEAAQADRIVVMDGGEVKMEGTPKEIFPQVEMM 241
gi 289579112 158 IAMKPECIILDEPTAMLDPIGRREVISTIKKLNKEEEITVILITHFMEEVVDADRVIVMDDGKVVLDGTPKEVFKEVELL 237
gi 302876503 160 LAMKPKCIVFDEATAMLDPSGRKEVMDTIEDL-RKSGITIILITHYMEEAAKADRIIVMDSGSIVLEGTPREVFSKVEEM 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 153938212 241 KKIGLDVPQMTEIAHYLRQHNVEIPSDILTIDEMVDELCQLK 282
gi 20808630  254 KKIGLDVPQVTELAHQLRKEGIDIPSDILTIEEMVEFICR-- 293
gi 167039550 238 KKIGLSVPQVTELAYQLKREGFDVPLDILTVEEMVEFLCR-- 277
gi 167036831 238 KKIGLSVPQVTELAHQLKREGFDVPLDILTVEEMVEFLCR-- 277
gi 15896353  240 KEIGLDVPQMTELAYELKKEGINVKDDILTIDEMVNELCRLK 281
gi 150015074 242 KKIGLDVPQVTELAYELKKAGIDINEKILNVDEMVNELCQLK 283
gi 187935419 242 KNIGLDVPQVTELTYELRKEGIDIPKEILNVDEMVNAICQLK 283
gi 188587979 242 KNIGLDVPQVTELAYELRKAGIDIPKEILNVDEMVNAICQLK 283
gi 289579112 238 KKIGLSVPQVTELAYQLKREGFDVPLDILTVEEMVEFLCR-- 277
gi 302876503 239 KALGLDVPQICELAYELQKEGIDVRSDILSIDEMVDALCQLK 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap