Conserved Protein Domain Family
PRK13409

?
PRK13409: PRK13409 
putative ATPase RIL; Provisional
Links
?
Statistics
?
PSSM-Id: 184037
View PSSM: PRK13409
Aligned: 88 rows
Threshold Bit Score: 913.424
Threshold Setting Gi: 41615088
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110667334   3 DDSIAVVDLDRCQ-PDRCNYECANYCPPNRTG-KECIVTrsdyydddepfDGDPN-QIRISEEVCLGesCGICVEKCPFD 79 
284998328   2 FVRVAVINYDFCK-PDKCNLECINFCPVDRSG-GKAIEL-----------SDIVKgKPVIYEETCIG--CGICVKKCPYE 66 
238620306   2 FVRVAVINYDFCK-PDKCNLECINFCPVDRSG-GKAIEL-----------SDIVKgKPVIYEETCIG--CGICVKKCPYE 66 
229585345   2 FVRVAVINYDFCK-PDKCNLQCINFCPVDRSG-GKAIELs----------DIVKG-KPVIYEETCIG--CGICVKKCPYE 66 
227830813   1 -MRVAVINYDFCK-PDKCNLECINFCPVDRSG-GKAIELs----------DIVKG-KPVIYEETCIG--CGICVKKCPYE 64 
229579709   2 FVRVAVINYDFCK-PDKCNLECINFCPVDRSG-GKAIELs----------DIVKG-KPVIYEETCIG--CGICVKKCPYE 66 
20093531    5 GRRVAVVDRERCKgGSKCDYVCQRFCPGVRTG-RETITI-----------DEDTN-KPVISEELCSG--CGICAQKCPFD 69 
146305004   1 -MRVAVINYDSCK-PDKCSIECVRFCPINRAG-SKAIEI-----------DQSKLgKPVVYEETCIG--CNICVKKCPFE 64 
156936833   5 VPRVAVIDKELCK-PDKCNYECIRFCPINKTGrNKAIEL------------GEDG-KPIIHELVCTG--CGICIKKCPFQ 68 
305662559   4 MVRVAVIDYELCH-PDKCGIPCIRFCPINKTKpYKAIEIs----------SEKKG-KPIIYEDKCIA--CGICIKKCPFK 69 
110667334  80 AIEIINLPVELEDdPVHRYGENAFALYGLPVPDPGTVTGILGPNGIGKTTAVRALAGELVPNLGEYTaeaaETATWDAVL 159
284998328  67 AISIVNLPDELEGeVIHRYKVNGFKLFGLPTPKNNTILGVLGKNGVGKTTVLKIVAGELIPNFGDPN----SKLGKDEVL 142
238620306  67 AISIVNLPDELEGeVIHRYKVNGFKLFGLPTPKNNTILGVLGKNGVGKTTVLKIVAGELIPNFGDPN----SKLGKDEVL 142
229585345  67 AISIVNLPDELEGeVIHRYKVNGFKLFGLPTPKNNTILGVLGKNGVGKTTVLKIVAGELIPNFGDPN----SKLGKDEVL 142
227830813  65 AISIVNLPDELEGeVIHRYKVNGFKLFGLPTPKNNTILGVLGKNGVGKTTVLKIVAGELIPNFGDPN----SKLGKDEVL 140
229579709  67 AISIVNLPDELEGeVIHRYKVNGFKLFGLPTPKNNTILGVLGKNGVGKTTVLKIVAGELIPNFGDPN----SKLGKDEVL 142
20093531   70 AIKVVRLPEELEEeCVHKYEEGGFRLYRLPVPKPGKVTGVIGRNAIGKTTAAKILTGELKPNLGDPE----ADPDWDEVI 145
146305004  65 AISIVNVPDNFSKeIIHRYGTNGFELFGLPILKSGYVIGLLGKNGAGKTTILKILSGEIIPNFGEVE----KQPSIDTVL 140
156936833  69 AIHIENLPEEVEEkLVHRYGKNGFALYGLPVPKRGQVTGIIGRNGAGKSTSLKILSGLLKPNLGK------EEASWDEVL 142
305662559  70 AIRIVNLPEEIEEnLIHRYAQNGFKLYGLPVPIKGKIVGVLGPNGAGKTTAMKILSGGIIPNLGDYT----SAPSIDRVL 145
110667334 160 DRYRGTKLQTYIERIRSDDISIAQKPQYVDQIPGQF-DGTTGELLESTDERGALDSYIDRLDIRPVIDQPLSTLSGGELQ 238
284998328 143 KKFRGKEIYNYFKELYNNGLKIIHKIQYVEYASKFL-KGTVNEILTKIDERGKKDEVKELLNMANLWNKDANVLSGGGLQ 221
238620306 143 KKFRGKEIYNYFKELYNNGLKIIHKIQYVEYASKFL-KGTVNEILTKIDERGKKDEVKELLNMANLWNKDANVLSGGGLQ 221
229585345 143 KKFRGKEIYNYFKELYNNGLKIIHKIQYVEYASKFL-KGTVNEILTKIDERGKKDEVKELLNMVNLWNKDANVLSGGGLQ 221
227830813 141 KKFRGKEIYNYFKELYNNGLKIIHKIQYVEYASKFL-KGTVNEILTKIDERGKKDEVKELLNMANLWNKDANVLSGGGLQ 219
229579709 143 KKFRGKEIYNYFKELYNNGLKIIHKIQYVEYASKFL-KGTVNEILTKIDERGKKDEVKELLNMANLWNKDANVLSGGGLQ 221
20093531  146 RAFSGTELQEHFRRIADGDLRPVMKPQYVEALPKVV-KGRVKDVLEDVDELGVVDELIERLGLTEVTDRRISDLSGGELQ 224
146305004 141 QKFKGKELFSYFYDLYNKKLRVVHKIQYVEYASRLL-KGEVSQLLRKVDERGKLDEIRELLFMNSIWNKEISTLSGGELQ 219
156936833 143 KRFRGTELFNYLKDLANGKIRVAYKLQYVAEAAKLL-KGTVGQLLARVDERGIAREVAQALNIAHLWERDVRKLSGGELQ 221
305662559 146 DKFRGTIFYDYFKKLYAKELKVVHKIQYIELIPSYIrKGTVREILDKVDERKMKKDVIEFLNMELMLDKDVSILSGGELQ 225
110667334 239 RVALAATLARDRDFYFLDEVSPYLDIAQRVTAARLIRELAEdaNRAVLVVEHDLAILDLLADSLHVAYGEPGAFGVITDP 318
284998328 222 RLLIAVSLLREADVYIFDEPSSYLDVRERMNMAKAIRELLK--NKYVMVVDHDLIVLDYLTDLIHIIYGESSVYGRVSKS 299
238620306 222 RLLIAVSLLREADVYIFDEPSSYLDVRERMNMAKAIRELLK--NKYVMVVDHDLIVLDYLTDLIHIIYGESSVYGRVSKS 299
229585345 222 RLLIAVSLLREADVYIFDEPSSYLDVRERMNMAKAIRELLK--NKYVMVVDHDLIVLDYLTDLIHIIYGESSVYGRVSKS 299
227830813 220 RLLIAVSLLREADVYIFDEPSSYLDVRERINMAKAIRELLK--NKYVMVVDHDLIVLDYLTDLIHIIYGESSVYGRVSKS 297
229579709 222 RLLIAVSLLREADVYIFDEPSSYLDVRERMNMAKAIRELLK--NKYVMVVDHDLIVLDYLTDLIHIIYGESSVYGRVSKS 299
20093531  225 RVAIAAALSRDADFLVFDEPCSYLDVEQRLSLARSLREIVEdrGIPMLVIEHDLATLDYVADVVHVLYGKRGAYGVVSKP 304
146305004 220 KTLIAAALAREANVYAIDEPSSYLDVRERINVAKGIRELTK--GKYVVTVDHDLIVLDYIADFVSIIYGESGVYGKVSKT 297
156936833 222 RFLIAAVLSKDADLYAFDEPAAYLDVKERINMARAIKKFVPp-NRYVLIIEHDLAILDYLSDLVHIVYGVPGVYGIVSQP 300
305662559 226 KLAIAVALLRDGNIYIFDEPSSYLDLKERLNMAITLRELLPm-DSYIFVVDHDLMLLDYLADQIVITYGVPGVYGIFSKV 304
110667334 319 KSVRNGINEYLKGFLSNENMRIRPNKIEFQEHAPRKTA-----KSTPLIEYPAISKSYgtDEFSLEVESGTIYESEVLGV 393
284998328 300 YAARVGINNFLKGYLPAENMKIRPDEIRFMLKEISDLDls--kDLKTKMKWTKIIKKL--GDFQLVVNEGEAKEGEIIGI 375
238620306 300 YAARVGINNFLKGYLPAENMKIRPDEIRFMLKEISDLDls--kDLKTKMKWTKIIKKL--GDFQLVVNEGEAKEGEIIGI 375
229585345 300 YAARVGINNFLKGYLPAENMKIRPDEIRFMLKEISDLDls--kDLKTKMKWTKIIKKL--GDFQLVVNEGEAKEGEIIGI 375
227830813 298 YAARVGINNFLKGYLPAENMKIRPDEIRFMLKEISDLDls--kDLKTKMKWTKIIKKL--GDFQLVVNEGEAKEGEIIGI 373
229579709 300 YAARVGINNFLKGYLPAENMKIRPDEIRFMLKEISDLDls--kDLKTKMKWTKIIKKL--GDFQLIVNEGEAKEGEIIGI 375
20093531  305 MGVGKGINAYLKGYLEAENVRFRDEEVVLPEKPAEAEAg----ERDTLVEYGELVKEYd-GDFRLEVEPGEIRVGEIIGA 379
146305004 298 YSTRVGINNFLNGYLPAENMRVMDHKIQFYLKDVTDLDla--kNSAEKVRWSNITKTL--GDFSLNTEQGFAREGEVIGI 373
156936833 301 YSTRVGINHYIRGFLPSENMRIRDKPITFVNPELREKVv----STEVYLEWPFMTKKL--GDFVLEVNPGEIHRGEIIGI 374
305662559 305 YSTNSGIDYYLNGYLPSENMKIRDEAVSFKFHETREEFtyiekTGEVLCSWSDLVKKL--DNFVLTVEHGEVHRGEVIGI 382
110667334 394 VGPNGIGKSTLAKLFTGALesDPDSQSLSFQ-LDIAYKPQYIEID---QPMRVDAFLSSI-TNDFG-TSYWKTEISQPLQ 467
284998328 376 LGPNGIGKTTFARILVGEI--SADEGSVTPEkQILSYKPQRILPN---YDGTVQQYLENVsKDALStSSWFFEEVTKRLN 450
238620306 376 LGPNGIGKTTFARILVGEI--SADEGSVTPEkQILSYKPQRILPN---YDGTVQQYLENVsKDALStSSWFFEEVTKRLN 450
229585345 376 LGPNGIGKTTFARILVGEI--SADEGSVTPEkQILSYKPQRILPN---YDGTVQQYLENVsKDALStSSWFFEEVTKRLN 450
227830813 374 LGPNGIGKTTFARILVGEI--SADEGSVTPEkQILSYKPQRILPN---YDGTVQQYLENVsKDALStSSWFFEEVTKRLN 448
229579709 376 LGPNGIGKTTFARILVGEI--SADEGSVTPEkQILSYKPQRILPN---YDGTVQQYLENVsKDALStSSWFFEEVTKRLN 450
20093531  380 LGPNAIGKTTFVKLLAGVL--EPTGGGVDVD-VKVSYKPQYLEVD---SDEPVEQVLRRTaGSEWG-SSWYRSNIVEPLD 452
146305004 374 VGPNGIGKTTFIRILVGEI--EPDSGSIVPTgLTLSYKPQRIVPD---YEGTVREYLESVsKDILStSSWFYTEVTRRLR 448
156936833 375 LGPNGIGKSTFIKLIAGIL--KPDNADFVLPqLRLAYKPQYVTHEmfgKNETVKDVLRKVrSDFLDtSSWYYVEVVKRLG 452
305662559 383 VGPNAIGKTTFIRILVGEL--TPDEGFTTSTaLKLSYKPQYLKRKi-dSCITVEECLKDInREALNeDHWLYQEVIKRLG 459
110667334 468 LEQIMERNLDDLSGGERQRVAIAACLSDDADLYVMDEPSAHLDVEQRVQATSAIRRYAENNDETVLVIDHDIYMIDLLAD 547
284998328 451 LHRLLESNVNDLSGGELQKLYIAVTLAKEADLYVLDEPSSYLDVEERYIVAKAIKRVVRERKAVTFIIDHDLSIHDYIAD 530
238620306 451 LHRLLESNVNDLSGGELQKLYIAATLAKEADLYVLDEPSSYLDVEERYIVAKAIKRVVRERKAVTFIIDHDLSIHDYIAD 530
229585345 451 LHRLLESNVNDLSGGELQKLYIAATLAKEADLYVLDEPSSYLDVEERYIVAKAIKRVVRERKAVTFIIDHDLSIHDYIAD 530
227830813 449 LHRLLESNVNDLSGGELQKLYIAATLAKEADLYVLDEPSSYLDVEERYIVAKAIKRVVRERKAVTFIIDHDLSIHDYIAD 528
229579709 451 LHRLLESNVNDLSGGELQKLYIAATLAKEADLYVLDEPSSYLDVEERYIVAKAIKRVVRERKAVTFIIDHDLSIHDYIAD 530
20093531  453 LEYLFDRPLCELSGGELQRVAVAAALSREADLYLLDEPSAYLDVEERINTARVIRRVIEARDAAAIVVDHDLLLLDYISD 532
146305004 449 LHKLLDSNVKDLSGGELQKLYVAGALAKEAHIYLLDEPSSYLDVEERYVVAKAIKRITRERKSVSFVVDHDLAIHDYIAD 528
156936833 453 LNRLLEKEVKHLSGGELQKLAVAVTLGKEADLYLLDEPSAFLDVEERLAVGDAIRHIVEGSGAAAFVVDHDLVMIDLITD 532
305662559 460 VDRLFKKEIENLSGGELQKFYVAQTLIRDADIYLLDEPSSHIDVEDQLSVARAIKKIARLRKAAIFVVDHNFLLIDYAVD 539
110667334 548 RLMVFDGQPSEYGHASAPQEMRAGMNDFLSDLDITFRRDERTQRPRINKPGSQLDRRQKQQGEYYYAP 615
284998328 531 RIIVFKGEPEKAGFATSPVTLKTGMNEFLRELEVTFRRDAETGRPRVNKIGSYLDRVQKERGEYYSMV 598
238620306 531 RIIVFKGEPEKAGFATSPVTLKTGMNEFLRELEVTFRRDAETGRPRVNKIGSYLDRVQKERGEYYSMV 598
229585345 531 RIIVFKGEPEKAGFATSPVTLKTGMNEFLRELEVTFRRDAETGRPRVNKIGSYLDRVQKERGEYYSMV 598
227830813 529 RIIVFKGEPEKAGFATSPVTLKTGMNEFLRELEVTFRRDAETGRPRVNKIGSYLDRVQKERGEYYSMV 596
229579709 531 RIIVFKGEPEKAGFATSPVTLKTGMNEFLRELEVTFRRDAETGRPRVNKIGSYLDRVQKERGEYYSMV 598
20093531  533 RMMVFEGEPGKHGRANPPESKREAMNRFLSNLGVTFRRDPETRRPRANKPGSHRDREQKRRGEYFYA- 599
146305004 529 RLIVFTGTPGKSGHASEPLSLSKGMNTFLKEIGLTFRRDAESGRPRANKIGSYLDRLQRERNEYYSTE 596
156936833 533 RVMVFKGEPGKHGVAEPPTSLRRGMNEFLKELGITFRRDPETGRPRVNKEGSRLDRMQKSIGEYYYTL 600
305662559 540 RLMTFIGIPTKKGYGKSPTTVGKAFNELLKELGLTVRRDKESGRPRINKPGSYLDRYQRELGMFFYYE 607
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap