Conserved Protein Domain Family
PRK12879

?
PRK12879: PRK12879 (this model, PSSM-Id:183809 is obsolete and has been replaced by 237245)
3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Statistics
?
PSSM-Id: 183809
View PSSM: PRK12879
Aligned: 92 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29832330    9 GAPYARILGVGGYRPVRVVPNDVILEKIDSSDEWIRSRSGIETRHWASDEetVAAMSIEASGKAIADAGITASQIGAVVV 88 
145300158   1 -MKYANITGWGKCLPPSVLTNDDLSTIMDTSDEWIYPRTGIKARRISHVS--TSDLATLAGRRALACAGLDASDLDGIIL 77 
161582040   2 TQCYAEITGWGKCLPPATLSNHDLSTFLDTSDEWIQSRTGIEQRRISHVN--TSDLATVAAQHAIACAGVSVEEIDLIIV 79 
162329618   2 TQCYAEITGWGKCLPPATLSNHDLSTFLDTSDEWIQSRTGIEQRRISHVN--TSDLATVAAQHAIACAGVSVEEIDLIIV 79 
156976915   2 TNYYAEITGWGKCLPPATLSNDDLSTFLETSDEWIRTRTGIENRRISHVN--TSDMATVAAQHAMARAGVEASDIDLIIV 79 
218676470   2 TKFYAEITGWGKCLPPAVLSNDDLSTFIDTSDEWIRTRTGIENRRISHVN--TSELATVAAQHAMACAGLTAKDIDLVII 79 
227812318  43 TQCYAEITGWGKCLPPATLSNHDLSTFLDTSDEWIQSRTGIEQRRISHVN--TSDLATVAAQHAIACAGVSVEEIDLIIV 120
229605623  43 TQCYAEITGWGKCLPPATLSNHDLSTFLDTSDEWIQSRTGIEQRRISHVN--TSDLATVAAQHAIACAGVSVEEIDLIIV 120
262395384   2 TNYYAEITGWGKCVPPAVLSNDDLSTFLDTSDEWIRTRTGIENRRISHVN--TSDMATVAAKHALARAGVDASDVDLIIV 79 
117617513   1 -MKYANITGWGKCLPPSVLTNDDLSTIMDTSDEWIYPRTGIKARRISHVS--TSDLATLAGRRALACAGLEASDLDGIIL 77 
29832330   89 STVSHFSQTPAIATEIADKLGTNKAAAFDISAGCAGFGYGLTLAKGMVVEGSAEYVLVIGVERLSDLTDLEDRATAFLFG 168
145300158  78 ATATPDNLLPSAASAVQKKLGAVNAAVFDLNAACTGFVYSLSVATSLVQTGMMKKVLVIGAERLTYLLDWARRDTAVLFG 157
161582040  80 ATCSPDSLIPNIASRVQQNLGIPSAAAFDLNAACTGFLYGLETATRLMQASHYRHALVIGAERLSFYLDWTKRDTAVLFG 159
162329618  80 ATCSPDSLIPNIASKVQQNLGIPSAAAFDLNAACTGFLYGLETATRLMQASHYRHALVIGAERLSFYLDWTKRDTAVLFG 159
156976915  80 ATCSPDSLIPNIASKVQQNLGIRSAAAFDLNAACTGFVYGLETGTRLIQSGNYRNAIIIGAERLSFYIDWAMRDTAVLFG 159
218676470  80 ATCSPDSLIPNTASKVQQNLGIKSAAAFDLNAACTGFIYGVETATRLIQAGNYRNAIVVGAERLSFFIDWTKRDTAVLFG 159
227812318 121 ATCSPDSLIPNIASKVQQNLGIPSAAAFDLNAACTGFLYGLETATRLMQASHYRHALVIGAERLSFYLDWTKRDTAVLFG 200
229605623 121 ATCSPDSLIPNIASRVQQNLGIPSAAAFDLNAACTGFLYGLETATRLMQASHYRHALVIGAERLSFYLDWTKRDTAVLFG 200
262395384  80 ATCSPDSLIPNIASKIQQNLGIRSAAAFDLNAACTGFVYGLETGTRLIQSGNYRNAIIIGAERLSFYIDWAMRDTAVLFG 159
117617513  78 ATATPDNLLPSAASAVQKKLGAVNAAVFDLNAACTGFVYSLSVATSLVQTGMMKKVLVIGAERLTYLLDWARRDTAVLFG 157
29832330  169 DGAGAVVVGPSE-EPHIGPTVWGSEGDKAGTIKQTVPWDRYlphsrlrssggtptgdvsplplDS-EGNVKFPAITQEGQ 246
145300158 158 DGAGAVVIEASEqECGLIANKLGCDSEAREILHVPNFGTDR----------------------VRfADVDGLFTFNFEGP 215
161582040 160 DGAGAVVLSKTEqKVGLQDAQIGCDAQGRDILAVPKFGTAM----------------------DRfDADNGYWAFDFVGK 217
162329618 160 DGAGAVVLSKTEqKVGLQDAQIGCDAQGRDILAVPKFGTAM----------------------DRfDADNGYWAFDFVGK 217
156976915 160 DGAGAVVLTRTEqETGLLQSQIGCDAKGRDILSVPKFGTCM----------------------DRfAEDNGYWDFNFVGQ 217
218676470 160 DGAGAVVLSRTEeQVGLQEAQIGCDAEGRDILAVPKFGTSM----------------------DRfAADNGYWDFDFVGK 217
227812318 201 DGAGAVVLSKTEqKVGLQDAQIGCDAQGRDILAVPKFGTAM----------------------DRfDADNGYWAFDFVGK 258
229605623 201 DGAGAVVLSKTEqKVGLQDAQIGCDAQGRDILAVPKFGTAM----------------------DRfDADNGYWAFDFVGK 258
262395384 160 DGAGAVVLSRTEkETGLLQSQIGCDAKGRDILSVPKFGTCM----------------------DRfAEDNGYWDFNFVGQ 217
117617513 158 DGAGAVVIEASEqECGLIANKLGCDSEAREILHVPNFGTDR----------------------VRfADIDGLFTFNFEGQ 215
29832330  247 AVFRWAVFEMAKVAQQALDAAGITSDDLDVFIPHQANERIIDSMVKTLKLPEHVTVArDVRTTGNTSAASIPLAMERLla 326
145300158 216 EIFKRAVRGMGEATSSVLAQAGIDPEQVDLIVPHQANIRIIETLAKRMNAPMEKVMV-NIENYGNTSAATVPIALCEAle 294
161582040 218 EIFKRAVRGMGAAAQQVLARSGLSTEEIDVVIPHQANIRIIQTLCDLAGIAQDKAFV-NIHRYGNTSAATVPIALCEAle 296
162329618 218 EIFKRAVRGMGAAAQQVLARSGLSTEEIDVVIPHQANIRIIQTLCDLAGIAQDKAFV-NIHRYGNTSAATVPIALCEAle 296
156976915 218 EIFKRAVKGMGLAAKTVLKASELTTDQIDVVIPHQANIRIIQTLCDLSGIPQEKAFV-NIQNYGNTSAATVPIALCEAle 296
218676470 218 EIFKRAVKGMGAAAHTVLSRTGISTDNIDVVIPHQANIRIIQTLCDMAGIEREKAFV-NIQNYGNTSAATVPIALCESle 296
227812318 259 EIFKRAVRGMGAAAQQVLARSGLSTEEIDVVIPHQANIRIIQTLCDLAGIAQDKAFV-NIHRYGNTSAATVPIALCEAle 337
229605623 259 EIFKRAVRGMGAAAQQVLARSGLSTEEIDVVIPHQANIRIIQTLCDLAGIAQDKAFV-NIHRYGNTSAATVPIALCEAle 337
262395384 218 EIFKRAVKGMGLAAKTVLKASQLTTDQIDVVIPHQANIRIIQTLCDLSGIPHDKAFV-NIQNYGNTSAATVPIALCEAve 296
117617513 216 EIFKRAVRGMGEATNTVLAQAGIAPEQIDLIVPHQANIRIIETLAKRMNAPMEKVMV-NIEHYGNTSAATVPIALCEAle 294
29832330  327 TGEAKSGDTALVIGFGAGLVYAATVVTLP 355
145300158 295 QGRVKPNSYLLTAAFGAGLTWGAAIIKWG 323
161582040 297 QGKIKPHDDLLVAAFGAGLTWGAGHIRWG 325
162329618 297 QGKIKPHDDLLVAAFGAGLTWGAGHIRWG 325
156976915 297 QGRVKSGDNMLLAAFGAGLTWGAAVLKWG 325
218676470 297 QGFVKPNSNILLAAFGAGLTWGAGHIKWG 325
227812318 338 QGKIKPHDDLLVAAFGAGLTWGAGHIRWG 366
229605623 338 QGKIKPHDDLLVAAFGAGLTWGAGHIRWG 366
262395384 297 QGRVNPGDNMLLAAFGAGLTWGAAVLKWG 325
117617513 295 QGRVQPNSYLLTAAFGAGLTWGAAIIKWG 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap