Conserved Protein Domain Family
PRK12545

?
PRK12545: PRK12545 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 183584
View PSSM: PRK12545
Aligned: 18 rows
Threshold Bit Score: 376.989
Threshold Setting Gi: 53715871
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PRK12545 is a member of the superfamily cl27139.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53715871    1 MQHARAAHDDPAYLAQLRHDLLRFARLQLRDADAAEDAVQEALAAAWAQAERFDGQSSHKTWVFGILRNKLIDTIRARRR 80
gi 124381431   1 MQHARAAHDDPAYLAQLRHDLLRFARLQLRDADAAEDAVQEALAAAWAQAERFDGQSSHKTWVFGILRNKLIDTIRARRR 80
gi 134292510   1 ---MPSTYDDPVYLAQLRRDLLRFARLQLRDADASEDAVQEALAAAWSHAGDFAGRSAHKTWVFGILRNKLVDILRARQR 77
gi 78060861    1 ---MPSAYDDPVYLAQLRRDLLRFARLQLRDADAAEDAVQEALTAAWSHAGDFAGLSAHKTWVFGILRNKLIDVLRARQR 77
gi 206561869   1 ---MPSAYDDPTYLAQLRRDLLRFARLQLRDADAAEDAVQEALAAAWSHAGDFAGQSAHKTWVFGILRNKLIDVLRARQR 77
gi 162218065   1 ---MLSAHDDPAYLAQLRHDLLRFARLQLRDADAAEDAVQEALAAAWSHAGEFAGLSAHKTWVFGILRNKLIDVLRARQR 77
gi 116693783  16 HSLMLSAHDDPAYLAQLRHDLLRFARLQLRDADAAEDAVQEALAAAWSHAGEFAGLSAHKTWVFGILRNKLIDVLRARQR 95
gi 170736916   1 ---MLSAHDDPAYLAQLRHDLLRFARLQLRDTDAAEDAVQEALTAAWSHAGEFAGLSAHKTWVFGILRNKLIDVLRARQR 77
gi 115359706   1 ---MPSAYDDPPYLTQLRRDLLRFARLQLRDADAAEDAVQEALTAAWSHAGEFAGRSAHKTWVFGILRNKLIDILRARQR 77
gi 172064523   1 ---MPSAYDDPPYLTQLRRDLLRFARLQLRDADAAEDAVQEALTAAWSHAGEFAGRSAHKTWVFGILRNKLIDILRSRQR 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53715871   81 TINASALDAELDGEALLERELFADNGHWAPHAKPRPWPKPETILQQRQFWILFETCLEHLPEQIGRVFMMREFLDFAIDD 160
gi 124381431  81 TINASALDAELDGEALLERELFADNGHWAPHAKPRPWPKPETILQQRQFWILFETCLEHLPEQIGRVFMMREFLDFAIDD 160
gi 134292510  78 TVSLTALDAELDGESVLDRELFQDNGHWAAHTKPRPWPRPETLLQQRQFWTLFQACLDHLPENIGRVFMMREFLDVEIDD 157
gi 78060861   78 TVSLSALDAELDGESVLDRELFKENGHWAAHAKPRPWPRPETLLQQQQFWTLFEACLDHLPEQIGRVFMMREFLDFEMTD 157
gi 206561869  78 MVSLTALDAELDGESVLDRELFKDNGHWAAHAKPRPWPKPETLLQQQQFWTLFQACLDQLPEQIGRVFMMREFLDVEIVD 157
gi 162218065  78 MVSLTALDAELDGESILDRELFKDNGHWAAHAKPRPWPKPDTLLQQQQFWTLFQVCLDHLPEQIGRVFMMREFLGVEIAD 157
gi 116693783  96 MVSLTALDAELDGESILDRELFKDNGHWAAHAKPRPWPKPDTLLQQQQFWTLFQVCLDHLPEQIGRVFMMREFLDVEIAD 175
gi 170736916  78 MVSLTALDAELDGESILDRELFKDNGHWAAHAKPRPWPKPDTLLQQQQFWTLFQVCLDHLPEQIGRVFMMREFLDVEIAD 157
gi 115359706  78 TVSLSALDAELDGESALDRELFKENGHWAAHTKPRPWPRPETLLQQQQFWTLFQVCLDHLPEHIGRVFMMREFLDVEIND 157
gi 172064523  78 TVSLSALDAELDGESALDRELFKENGHWAAHTKPRPWPRPETVLQQQQFWTLFQVCLDHLPEHIGRVFMMREFLDVEIND 157
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 53715871  161 ICTELELKANHCSVLLYRARTRLRTCLTEKGLTTEDATGEM 201
gi 124381431 161 ICTELELKANHCSVLLYRARTRLRTCLTEKGLTTEDATGEM 201
gi 134292510 158 ICSELTLTANHCSVLLYRARTRLRTCLSEKGLTTEDAAGEM 198
gi 78060861  158 ICSELTLTTNHCSVLLYRARTRLRTCLSEQGLTTEDAAGEM 198
gi 206561869 158 ICSELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEM 198
gi 162218065 158 ICNELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEM 198
gi 116693783 176 ICNELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEM 216
gi 170736916 158 ICNELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEM 198
gi 115359706 158 ICTELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEM 198
gi 172064523 158 ICTELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEM 198
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap