Conserved Protein Domain Family
PRK12516

?
PRK12516: PRK12516 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 183568
View PSSM: PRK12516
Aligned: 21 rows
Threshold Bit Score: 378.539
Threshold Setting Gi: 209550600
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PRK12516 is a member of the superfamily cl27136.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82700449    4 TTGPSVEGAPPFKRELLASLPSLRAFAVSLIGQHDRADDLVQDTIMKAWAKQESFEVGTNMKAWLFTILRNEFYTQMRKR 83
gi 163845242   4 TTGPSVEGTPPFKRELLASLPSLRAFAVSLIGQHDRADDLVQDTIMKAWAKQESFEVGTNMKAWLFTILRNEFYTQMRKR 83
gi 222086785   1 -----MEQQPSFKRELLAALPSLRAFAISLTGRHDRADDLVQDTIMKAWAKQDHFEMGTNMKAWLFTILRNELYSQMRKS 75
gi 227823002   1 -----MSENEEFKREMLAALPSLRAFAMSLIGRHDRADDLVQDTIMKAWAKQDHFEMGTNMKAWLFTILRNELYSQMRKR 75
gi 241205966   1 ---MEDKSQPSFKRELLAALPSLRAFAISLIGRHDRADDLVQDTIMKAWAKQDHFEMGTNMKAWLFTILRNELYSQMRKS 77
gi 209550600   1 ---MEDKAQPSFKRELLAALPSLRAFAISLIGRHDRADDLVQDTIMKAWAKQDHFEMGTNMKAWLFTILRNELYSQMRKS 77
gi 116253443   1 ---MEDKSQPSFKRELLAALPSLRAFAISLIGRHDRADDLVQDTIMKAWAKQDHFEMGTNMKAWLFTILRNELYSQMRKS 77
gi 86358872    1 ---MEEKLQPSFKRELLAALPSLRAFAISLIGRHDRADDLVQDTIMKAWAKQDHFEMGTNMKAWLFTILRNELYSQMRKS 77
gi 190893101   1 ---MEDKVQPSFKRELLAALPSLRAFAISLIGRHDRADDLVQDTIMKAWAKQDHFEMGTNMKAWLFTILRNELYSQMRKS 77
gi 15966188    1 ----MSSENQEFKREMLAALPSLRAFAMSLIGRHDRADDLVQDTIMKAWAKQDHFEIGTNMKAWLFTILRNELYSQMRKR 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82700449   84 GREVQDTDGMFSEQLAVHPSQYGTLDLQDFRAALDQLPDDQREAIILIGASGFAYEEAAEICGCAVGTIKSRVSRARARL 163
gi 163845242  84 GREVQDTDGMFSEQLAVHPSQYGTLDLQDFRAALDQLPDDQREAIILIGASGFAYEEAAEICGCAVGTIKSRVSRARARL 163
gi 222086785  76 GREVQDSDGLFTESMATHPSQYGALDLQDFRKALDQLPPDQREAIILVGASGFSYEEAAEICGCAVGTIKSRVNRARQRL 155
gi 227823002  76 GREIQDSDGHFTETLAHHPEQYGSLDLQDFRRALDQLPPDQREAIILVGASGFSYEEAATICGCALGTIKSRVNRARQRL 155
gi 241205966  78 GREVQDSDGLFTESMAMHPSQYGALDLQDFKKALDQLPPDQREAIILVGASGFSYEEAAEICGCAVGTIKSRVNRARQRL 157
gi 209550600  78 GREIQDSDGLFTESMAMHPSQYGALDLQDFKKALDQLPPDQREAIILVGASGFSYEEAAEICGCAVGTIKSRVNRARQRL 157
gi 116253443  78 GREVQDSDGLFTESMAMHPSQYGALDLQDFKKALDQLPPDQREAIILVGASGFSYEEAAEICGCAVGTIKSRVNRARQRL 157
gi 86358872   78 GREVQDSDGLFTESMAMHPSQYGALDLQDFKKALDQLPPDQREAIILVGASGFSYEEAAEICGCAVGTIKSRVNRARQRL 157
gi 190893101  78 GREVQDSDGLFTESMAMHPSQYGALDLQDFKKALDQLPPDQREAIILVGASGFSYEEAAEICGCAVGTIKSRVNRARQRL 157
gi 15966188   77 GREVQDSDGHLTETLAHHPEQYGSLDLQDFRRALEQLPPDQREAIILVGASGFSYEEAATICGCALGTIKSRVNRARQRL 156
                        170       180
                 ....*....|....*....|....*..
gi 82700449  164 QEILQIEGEADYGPDADSSRATLRSFA 190
gi 163845242 164 QEILQIEGEADYGPDADSSRATLRSFA 190
gi 222086785 156 QEVLQISGEADFGPDATSAPLTSKAFA 182
gi 227823002 156 QEILQVQGENDYGPDETSAPITSRAFV 182
gi 241205966 158 QELLQISGEADFGPDATSAPLTSKAFA 184
gi 209550600 158 QELLQISGEADFGPDATSAPLTSKAFA 184
gi 116253443 158 QELLQISGEADFGPDATSAPLTSKAFA 184
gi 86358872  158 QELLQISGEADFGPDATSAPLTSKAFA 184
gi 190893101 158 QELLQISGEADFGPDATSAPLTSKAFA 184
gi 15966188  157 QEILQVRGENDYGPDETSAPITSRAFV 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap