Conserved Protein Domain Family
PRK11634

?
PRK11634: PRK11634 (this model, PSSM-Id:183247 is obsolete and has been replaced by 236941)
ATP-dependent RNA helicase DeaD; Provisional
Statistics
?
PSSM-Id: 183247
View PSSM: PRK11634
Aligned: 97 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161484874   2 TTELETSFADLGLSAPILSALTDLGYEKPSPIQLECIPHLLNGRDVLGMAQTGSGKTAAFGLPLLHNIKADLKSPQVLVL 81 
197287236   7 TTETDMTFADLGLSAPILTALNDLGYEKPSPIQQQCIPFLLDGNDVLGMAQTGSGKTAAFSLPLLHNLDESLKAPQILVL 86 
300721544   2 TTETEISFADLGLSAPILSALGDMGYEKPSPIQQQCIPHLLNGRDVLGMAQTGSGKTAAFTLPLLHNINAELKAPQILVL 81 
253991496   7 TTETEISFADLGLSAPILSALEDLGYEKPSPIQQQCIPHLLNGRDVLGMAQTGSGKTAAFSLPLLHNINAELKAPQILVL 86 
161579561   2 TTETEISFADLGLSAPILSALEDLGYEKPSPIQQQCIPHLLNGRDVLGMAQTGSGKTAAFSLPLLHNINAELKAPQILVL 81 
261820134   1 MTDLSTSFSDLGLSAPIINALTDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFALPLLNNLKPELKAPQMLVL 80 
253686992   1 MTDLVTSFADLGLNTSILNALTDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLNNLKPELKAPQILVL 80 
50119665    1 MTDLFTSFSDLGLSAPIINALTDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFALPLLNNLKPELKAPQMLVL 80 
271499180   1 MAEFETSFASLGLSAPILNALSEMGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLNNIKADLKAPQLLVL 80 
251791029   1 MAEFETSFASLGLSAPILNALSEMGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLNNIKADLKAPQLLVL 80 
161484874  82 APTRELAVQVAEALSSFSKHINGVNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLNLSNLSGLVLDEADE 161
197287236  87 APTRELAVQVAEAIEDFSKHLPKVNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLNRGTLDLSKLKGLVLDEADE 166
300721544  82 APTRELAVQVAEACSDFSKHMRSVNVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSNLKGLVLDEADE 161
253991496  87 APTRELAVQVAEACADFSKHMRNVNVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE 166
161579561  82 APTRELAVQVAEACADFSKHMRNVNVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE 161
261820134  81 APTRELAVQVAEACNDFAKHMHGVNVVALYGGQRYDVQLRALRGGAQIVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE 160
253686992  81 APTRELAVQVAEACNDFSKHMHGVNVVALYGGQRYDVQLRALRQGAQIVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE 160
50119665   81 APTRELAVQVAEACSDFAKHMHGVNVVALYGGQRYDVQLRALRGGAQIVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE 160
271499180  81 APTRELAVQVAEACNEFSKHMQGVNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE 160
251791029  81 APTRELAVQVAEACNEFSKHMQGVNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE 160
161484874 162 MLRMGFIEDVETIMAQIPAEHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWRVgGGYRKNEALVRF 241
197287236 167 MLRMGFIEDVENILSKIPAEHQTALFSATMPEAIRRITRRFMNDPKEVRIQSSVTTRPDISQSYWMT-YGARKNEALIRF 245
300721544 162 MLRMGFIEDVENIMSQIPAEHQTALFSATMPEAIRRITRRFMNDPQEVRIQSSVTNRPDISQSYWSV-YGVRKNEALVRF 240
253991496 167 MLRMGFIEDVENIMSQIPAEHQTALFSATMPEAIRRITRRFMNDPQEVRIQASVTTRPDISQSYWSV-YGMRKNEALVRF 245
161579561 162 MLRMGFIEDVENIMSQIPAEHQTALFSATMPEAIRRITRRFMNDPQEVRIQASVTTRPDISQSYWSV-YGMRKNEALVRF 240
261820134 161 MLRMGFIEDVENIMAQIPATHQTALFSATMPEAIRRITRRFMKDPQEVRIQSSVTTRPDISQSYWTV-QGMRKNEALVRF 239
253686992 161 MLRMGFIEDVENIMAQIPAEHQTALFSATMPEAIRRITRRFMKDPQEVRIQSSITTRPDISQSYWTV-QGMRKNEALVRF 239
50119665  161 MLRMGFIEDVENIMAQIPATHQTALFSATMPEAIRRITRRFMKDPQEVRIQSSVTTRPDISQSYWTV-QGMRKNEALVRF 239
271499180 161 MLRMGFIEDVENIMAQIPAEHQTALFSATMPEAIRRITRRFMNDPQEVRIQSSVTTRPDISQSYWTV-YGMRKNEALIRF 239
251791029 161 MLRMGFIEDVENIMAQIPAEHQTALFSATMPEAIRRITRRFMNDPQEVRIQSSVTTRPDISQSYWTV-YGMRKNEALIRF 239
161484874 242 LEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVN 321
197287236 246 LEAEDFDAAIIFVRTKNATLEVAETLERNGYNSAALNGDMNQSLREQTLERLKNGRLDILIATDVAARGLDVDRISLVVN 325
300721544 241 LEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQTLREQTLERLKNGRLDILIATDVAARGLDVERISLVVN 320
253991496 246 LEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVN 325
161579561 241 LEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVN 320
261820134 240 LEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVN 319
253686992 240 LEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVN 319
50119665  240 LEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVN 319
271499180 240 LEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVDRISLVVN 319
251791029 240 LEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVDRISLVVN 319
161484874 322 YDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLQNIERTMKLTIPEVELPNADLLSERRLAKFAAKVSQQLESSD 401
197287236 326 YDIPMDSESYVHRIGRTGRAGRAGRAILFVDNRERRLLRNIERTMKMSIPEVELPNAELISQRRQEKFAQQIAQQLETSN 405
300721544 321 YDIPMDAESYVHRIGRTGRAGRAGRALLFVENRERRLLRNIERTMKLTIPEVELPDAELLGQRRLEKFAANVQQQLESSD 400
253991496 326 YDIPMDAESYVHRIGRTGRAGRAGRALLFVENRERRLLRNVERTMKLTIPEVELPNAELLSQRRLEKFAANVQQQLESSD 405
161579561 321 YDIPMDAESYVHRIGRTGRAGRAGRALLFVENRERRLLRNVERTMKLTIPEVELPNAELLSQRRLERFAANVQQQLESSD 400
261820134 320 YDIPMDAESYVHRIGRTGRAGRAGRALLFVENRERRLLRNVERTMKLTIPEVELPNAELLGQRRLAKFAAKVQQQLESSD 399
253686992 320 YDIPMDAESYVHRIGRTGRAGRAGRALLFVENRERRLLRNVERTMKLTIPEVELPNAELLGQRRLAKFAAKVQQQLESSD 399
50119665  320 YDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNVERTMKLAIPEVELPNAELLGQRRLAKFAAKVQLQLESSD 399
271499180 320 YDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNIERIMKLTIPEVELPNAELLGQRRLAKFAAKVQQQLESSD 399
251791029 320 YDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNIERTMKLTIPEVDLPNAELLGQRRLAKFAAKVQQQLESSD 399
161484874 402 LDMYRALLAKLQPE--EEFDIETLAAALLKMAQGERPLILPPEAPR--RPQREFNSRD-DR-----------GNDRGSrd 465
197287236 406 LDQYRALLPKLAPQgeEALDMETLAAVLLKMAQGERALILPPDPVR--RPRREFNDRD-DR-----------RNDR---- 467
300721544 401 LDQYRALLAKLGTD--EELEMETLAAALLKMAQGERPLILPPDPVR--RPRREFNDRD-DRrrngngfgdrdKSDRGD-- 473
253991496 406 LDQYRALLSKLQPA--EDLDIETLAAALLKMAQGERPLILPPDPVR--RPRREFNERD--------------DRRRNGfd 467
161579561 401 LDQYRTLLSKLQPA--EDLDIETLAAALLKMAQGERPLILPPDPVR--RPRREFNERD-DRrr-------ngFDDRGEr- 467
261820134 400 LDMYRALLTKLQPQ--EELDIETLAAALLKMAQGERPLILPPDPAF--RPRREFRDRDeSRsds------rgdRRRDPrd 469
253686992 400 LDMYRALLTKLQPQ--EELDVETLAAALLKMAQGERPLILPPDPVF--RPRREFRDRDdSRgd-------rrRDPRDSre 468
50119665  400 LDMYRALLTKMQPQ--EELDIETLAAALLKMAQGERPLILPPEPAF--RPRREFRDRDeSRsdsrgdrrrepRDARDSre 475
271499180 400 LDMYRALLGKLQPQ--EELDIETLAAALLKMAQGERPLILPPDPVVerRPRREFRDRD-ERfer-----rgeRNDRAP-- 469
251791029 400 LDMYRALLGKLQPQ--EELDIETLAAALLKMAQGERPLILPPDPVVerRPRREFRERD-DRfer-----rgeRNERGP-- 469
161484874 466 rGDSRrdnrsdsrsadsrdgGERPaRRERRDVGEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTI 545
197287236 468 --------------------ERSP-RRERRDAGEMDLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLYGSHSTI 526
300721544 474 -RGDR---------------GDRP-RRERRDVGDMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFATHSTI 536
253991496 468 dRGER---------------GDRP-RRERRDVGEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFATHSTI 531
161579561 468 --------------------SDRP-RRERRDVGEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFATHSTI 526
261820134 470 sRESRd--------------GDRPqRRERRESGEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFGSHSTI 535
253686992 469 sRD-----------------GDRPqRRERRDAGEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTI 531
50119665  476 pRD-----------------GDRPqRRERRESGEMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFGSHSTI 538
271499180 470 -RG-----------------DDRPaRRERREVGEMDLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTI 531
251791029 470 -RGG----------------DERPaRRERRDVGEMDLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTI 532
161484874 546 ELPKGMPGEMLSHFTRTRILNKPLNMQLLGDAQPHErrerpaggnGGERR-GG---GRPF-SGERRE---------Gaga 611
197287236 527 ELPKGMPGDLLSHFTRTRIMNKPLNMQLVGDAQPYR-----------ERR-----------NSSRRD---------Gqp- 574
300721544 537 ELPKGMPGELLSHFTRTRILNKPLNMQLMGDAQPFErrerrgggrNGNGN-GG--------NGPRRDrdnagngnnG--- 604
253991496 532 ELPKGMPGDLLSHFTRTRILNKPMNMQLMGDAQPFErrerrgggrNG----NG--------NAPRRDres---fngG--- 593
161579561 527 ELPKGMPGDLLSHFTRTRILNKPMNMQLMGDAQPFErre-----rrGGGR-NGngnGNSSgSGPRRDren---fngG--- 594
261820134 536 ELPKGMPGDLLSHFTRTRILNKPMNMQLLGDAVAQPer------rGGNRP-AG------A-GGERRD---------Gaa- 591
253686992 532 ELPKGMPGDLLSHFTRTRILNKPMNMQLLGDAQPHE------------RR-GG---GRP--GGERRD---------Gaa- 583
50119665  539 ELPKGMPGDLLSHFTRTRILNKPMNMQLLGDAVAQP----------ERRG-GGrpaGAGT-GGERRD---------Gaa- 596
271499180 532 ELPKGMPGDLLSHFTRTRILNKPMNMQLMGEAQPHErre---rrdGGERSdRG---ARGF--GDRTG---------G--- 591
251791029 533 ELPKGMPGDLLSHFTRTRILNKPMNMQLMGEAQPHErrerreggeRGERG------ARGF--GDRAG---------S--- 592
161484874 612 ppRRS--F-SGDRAPT-GGGE---RRGNRDGQRSA--------APRRDDaaapaaaaaAPARRRF-GDA 664
197287236 575 qgGRR--FsKGDQPPRrGNGEr--GNFRGRGNNEN--------APRRRS---------SSHNQ------ 616
300721544 605 --GRR--F-NNERRGGgERGSf--RGRNNDNFSGG--------APRRRQ---------SNDNGNStSNV 649
253991496 594 --GRR--F-SGERRG--GEGQs--RSNFRGRSDDH--------GPS------------AAPRRRYsNSN 633
161579561 595 --GRR--F-NGERRGGeGRGEg-------QSRSNF--------RGRGDDhg------sSAPRRRYnNSN 637
261820134 592 -pRRS--FgGGERRES--------NGNGGERRERSfnrdaaprAPRRRP-----------------ADA 632
253686992 584 -pRRS--FgGGERREG-NGGErreRSFNRDNRDGA-----------------------SRAPRRRpADA 625
50119665  597 -pRRS--FgGGERREG--------NANGGERRERSvnrdaaprAPRRRP-----------------ADA 637
271499180 592 --GRGrpF-SGERREG-G------ERRGGNRDGQR--------APRRFN------------------DA 624
251791029 593 --GRGrpF-SGERREG-GE-----RRGNRDGQR----------APRRFN------------------DA 624
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap