Conserved Protein Domain Family
PRK11058

?
PRK11058: PRK11058 
GTPase HflX; Provisional
Statistics
?
PSSM-Id: 182934
View PSSM: PRK11058
Aligned: 111 rows
Threshold Bit Score: 821.656
Threshold Setting Gi: 227080560
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54310429    1 MFDRYETGEQAILVHINFTQDGEWEDLSECEMLVSSAGVNTLRVVTGSRKTPLPKYYVGEGKAQEIADAVRAEEAEIVIF 80
gi 147673365   1 MFDRYEAGERAVLVHVNFTQRGEWEDLSECKMLISSAGVTTLHVVTGSRQTPHPKYFVGEGKAQEIAEAVQMHGANVVIF 80
gi 227080560   1 MFDRYEAGERAVLVHVNFTQRGEWEDLSECKMLISSAGVTTLHVVTGSRQTPHPKYFVGEGKAQEIAEAVQMHVANVVIF 80
gi 218708324   1 MFDRYESGERAVLVHINFTQEGEWEDLSECEMLVSSAGVETLQVITGSRQSPLPKYYVGEGKALEIAQAVQLTGAEIVIF 80
gi 28899590    1 MFDRYESGERAVLVHINFTQEGEWEDLAEFEMLVSSAGVETLQVVTGSRQSPHPKYYVGEGKAQEIATTVHLTGAEIVIF 80
gi 37681254    1 MFDRYESGERAVLVHVNFTQQGEWEDLAECEMLVSSSGVETLQVITASRQSPHAKYYVGEGKAQEIAQAVQLTGAEIVIF 80
gi 27364695    1 MFDRYESGERAVLVHVNFTQQGEWEDLAECEMLVSSSGVETLQVITASRQSPHAKYYVGEGKAQEIAQAVQLTGAEIVIF 80
gi 15640375    1 MFDRYEAGERAVLVHVNFTQRGEWEDLSECKMLISSAGVTTLHVVTGSRQTPHPKYFVGEGKAQEIAEAVQMHVANVVIF 80
gi 229606370   1 MFDRYEAGERAVLVHVNFTQRGEWEDLSECKMLISSAGVTTLHVVTGSRQTPHPKYFVGEGKAQEIAEAVQMHVANVVIF 80
gi 209696182   1 MFDRYESGEQAILVHISFTYEGELEDLNECKMLISSAGANTLGVVTGTRQSPLPKYYVGLGKAQEIANMVRAKNADIVIF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54310429   81 NHSLSPAQERNLEQLCQCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 147673365  81 NHALSPAQERNLERLCQCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 227080560  81 NHALSPAQERNLERLCQCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 218708324  81 NHSLSPAQERNLEQLCKCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 28899590   81 NHSLSPAQERNLEALCKCRVLDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 37681254   81 NHALSPAQERNLERLCQCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 27364695   81 NHALSPAQERNLERLCQCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 15640375   81 NHALSPAQERNLERLCQCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 229606370  81 NHALSPAQERNLERLCQCRVIDRTGLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
gi 209696182  81 NHALSPAQERNLEALCECRVIDRNGLILDIFAQRARTYEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54310429  161 ETDRRLLRDRIKTILRRLDKVSKQREQGRRARNRAEIPTISLVGYTNAGKSTLFNRITDAGVYVADQLFATLDPTLRKID 240
gi 147673365 161 ETDRRLLRERIKAILRRLEKVAKQREQGRRARSRAEIPTISLVGYTNAGKSTLFNRITEAGVYAADQLFATLDPTLRKID 240
gi 227080560 161 ETDRRLLRERIKAILRRLEKVAKQREQGRRARSRAEIPTISLVGYTNAGKSTLFNRITEAGVYAADQLFATLDPTLRKID 240
gi 218708324 161 ETDRRLLRDRIKAILRRLAKVAKQREQGRRARNRAEIPTISLVGYTNAGKSTLFNRITSAGVYAADQLFATLDPTLRKID 240
gi 28899590  161 ETDRRLLRERIKAILRRLEKVAKQREQGRRARNRAEIPTISLVGYTNAGKSTLFNRITEAGVYAADQLFATLDPTLRKME 240
gi 37681254  161 ETDRRLLRERIKAILRRLEKVAKQREQGRRARNRAEIPTISLVGYTNAGKSTLFNRITEAGVYAADQLFATLDPTLRKIE 240
gi 27364695  161 ETDRRLLRERIKAILRRLEKVAKQREQGRRARNRAEIPTISLVGYTNAGKSTLFNRITEAGVYAADQLFATLDPTLRKIE 240
gi 15640375  161 ETDRRLLRERIKAILRRLEKVAKQREQGRRARSRAEIPTISLVGYTNAGKSTLFNRITEAGVYAADQLFATLDPTLRKID 240
gi 229606370 161 ETDRRLLRERIKAILRRLEKVAKQREQGRRARSRAEIPTISLVGYTNAGKSTLFNRITEAGVYAADQLFATLDPTLRKID 240
gi 209696182 161 ESDRRLLRDRIKAIQRRLAKVAKQREQGRRARYRAEIPTISLVGYTNAGKSTLFNRITDAGVYAADQLFATLDPTLRKID 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54310429  241 VADVGTAILADTVGFIRHLPHDLVAAFKATLKETQEATLLLHVVDASDERFRENMDAVHLVLDEIDAGDVPRLIVMNKID 320
gi 147673365 241 LVDVGPAVLADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDERFRENIQAVETVLQEIDAHEVPTLLVMNKID 320
gi 227080560 241 LVDVGPAVLADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDERFRENIQAVETVLQEIDAHEVPTLLVMNKID 320
gi 218708324 241 LADVGPAILADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDDRFRENIQAVHEVLEEIDAHEVPTLVVMNKID 320
gi 28899590  241 LADVGPAILADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDERFRENIQAVHEVLEEIDAHEVPTLVVMNKID 320
gi 37681254  241 LADVGPAILADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDERFRENIQAVHVVLEEINAHEIPTLVVMNKID 320
gi 27364695  241 LADVGPAILADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDERFRENIQAVHVVLEEINAHEIPTLVVMNKID 320
gi 15640375  241 LVDVGPAVLADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDERFRENIQAVETVLQEIDAHEVPTLLVMNKID 320
gi 229606370 241 LVDVGPAVLADTVGFIRHLPHDLVAAFKATLQETQEADILLHVVDASDERFRENIQAVETVLQEIDAHEVPTLLVMNKID 320
gi 209696182 241 VTDVGTAILADTVGFIRHLPHDLVAAFKATLQETQEANILLHVVDASDERFRENIEAVDIVLEEIDANEVPYLLVMNKID 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54310429  321 CLDGAEPRIERDEDGLPRCVWVSAMEGIGIDLLFQALTERLSGTMIKHTLRLPPeNAGRYRSTFYQLGCILREEYESDGC 400
gi 147673365 321 NLEEQSPRIERDDEGVPRVVWISAMQGAGTELLFEALSERLASQVVEHHLRIPPrHQGRIRSTFFQMNCIQQEEYDPEGN 400
gi 227080560 321 NLEEQSPRIERDDEGVPRVVWISAMQGAGTELLFEALSERLASQVVEHHLRIPPrHQGRIRSTFFQMNCIQQEEYDPEGN 400
gi 218708324 321 CMEDQKPRIERDEEGAPRAVWVSAMEGEGIELLFEALTERLASQMVQFRLCIPHqHQGRIRSLFFEMKCIQQEEYDENGN 400
gi 28899590  321 NLESQTPRIERDEEGVPRAVWVSAMEGLGIELLFDALTERLASQMVEHQLRIPPqYQGRFRSTFFQMKCIQREEYDQDGN 400
gi 37681254  321 NMEDQRPRIERDDEGVPQVVWLSAMDGQGIDLLFEALTERLASSMVECQLRIPPqHQGRFRSTFFQMKCIQQEEYDQDGN 400
gi 27364695  321 NMEDQRPRIERDDEGVPQVVWLSAMDGQGIDLLFEALTERLASSMVECQLRIPPqHQGRFRSTFFQMKCIQQEEYDQDGN 400
gi 15640375  321 NLEEQSPRIERDDEGVPRVVWISAMQGAGTELLFEALSERLASQVVEHHLRIPPrHQGRIRSTFFQMNCIQQEEYDPEGN 400
gi 229606370 321 NLEEQSPRIERDDEGVPRVVWISAMQGAGTELLFEALSERLASQVVEHHLRIPPrHQGRIRSTFFQMNCIQQEEYDPEGN 400
gi 209696182 321 DLEDQQPRIDRDEEGVPRCVWVSAMEGEGIDLLFQALTERLAGQMVEHTLRLPPeLVGRFRSKFFQMQSIIKEEYQDDGS 400
                        410       420
                 ....*....|....*....|....*...
gi 54310429  401 LMVDIRLPLADWSRLQKRESNlLDDFIV 428
gi 147673365 401 LLITVRMQQVDWARLEKREQAdLCDFIV 428
gi 227080560 401 LLITVRMQQVDWARLEKREQAdLCDFIV 428
gi 218708324 401 LLIDIRMQQIDWSKLEKREGAlLGGFIV 428
gi 28899590  401 LLIDIRMQQVDWSRLEKREGAvLTDFIV 428
gi 37681254  401 LLIDIRMQQVDWSRLEKREGAvLSDFIV 428
gi 27364695  401 LLIDIRMQQVDWSRLEKREGAvLSDFIV 428
gi 15640375  401 LLITVRMQQVDWARLEKREQAdLCDFIV 428
gi 229606370 401 LLITVRMQQVDWARLEKREQAdLCDFIV 428
gi 209696182 401 LLIDIRMQQVDWSKLEKREETpLSYFLM 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap