Conserved Protein Domain Family
PRK10673

?
PRK10673: PRK10673 
acyl-CoA esterase; Provisional
Statistics
?
PSSM-Id: 182637
View PSSM: PRK10673
Aligned: 85 rows
Threshold Bit Score: 500.027
Threshold Setting Gi: 156934810
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242238567   5 MKLNYRWQNAQQPQNRLPVILIHGLFGTLDNLGVLARDLQQRHDTVQIDLRNHGLSPRAPEMNYSVMAEDICQLINELGC 84 
290474130   5 NQLNYHFHTPENPQSSTPIVLIHGLFGDLSNLGILGRDLQQHYPVIQIDVRNHGISPQMENMNYRDMAQDVLSLLDELNV 84 
300722362   5 SQLNYHFHIPENPQSATPIVLIHGLFGDLNNLGILGRDLQQHYPVIQIDVRNHGISPRMENMDYRDMAQDVLTLLDELNV 84 
294504439   1 MKLNFRLQNAPSPTSALPIILIHGLFGNLDNLGVLARDLQQHHNVIQVDLRNHGLSPRAPQMDYPVIAQDVLALMDELAI 80 
51595475    1 MKLNFRLQNAQSPTSALPIILIHGLFGNLDNLGVLARDLQQHHNVIQVDLRNHGLSPRAPQMDYPVMAQDVLALMDELAI 80 
153949154   1 MKLNFRLQNAPSPTSALPIILIHGLFGNLDNLGVLARDLQQHHNVIQVDLRNHGLSPRAPQMDYPVMAQDVLALMDELAI 80 
170025208   1 MKLNFRLQNAPSPTSALPIILIHGLFGNLDNLGVLARDLQQHHNVIQVDLRNHGLSPRAPQMDYPVMAQDVLALMDELAI 80 
186894507   1 MKLNFRLQNAQSPTSALPIILIHGLFGNLDNLGVLARDLQQHHNVIQVDLRNHGLSPRAPQMDYPVMAQDVLALMDELAI 80 
123443184   1 MKLNFRQQNALSPTSSLPIILIHGLFGNLDNLGVLARDLHKDHDVIQVDLRDHGLSPRSPEVNYPDMAQDVLELMDRLEI 80 
253990485   5 GQLNYHMQVPENPVSTTPIVLIHGLFGDLNNLGVLARDLQQHYPIIQVDVRNHGSSPWVDNIDYRDMAQDIISLLDHLKI 84 
242238567  85 ERVILIGHSMGGKASMALSAQLPERIDRIVAIDIAPVDYQVRRHDKVFAAIRAVSEAGVIRRSEAADLMRPYLpGEEGIV 164
290474130  85 AKAIIIGHSMGGKIAMTMTAVAPERIEQIVVIDIAPVTYLTRHHDSIFSALNQVKEAGAQTRQAATEVMRKDI-HEDGVI 163
300722362  85 PKATIIGHSMGGKIAMTMTAIAPERIEKIVVIDIAPIAYPVHRHDSIFSALNKVTAAGAATRQIAADIMRQDI-REEGVI 163
294504439  81 TQAIIIGHSMGGKVAMAMTALAPNRVEKLVAIDIAPVNYQVRRHDTIFAALNAVSAAGVTQRNEAAQLMRTLI-KEEGVI 159
51595475   81 TQAIIIGHSMGGKVAMAMTALAPNRVEKLVAIDIAPVNYQVRRHDTIFAALNAVSAAGVTQRNEAAQLMRTLI-KEEGVI 159
153949154  81 AQAIIIGHSMGGKVAMAMTALAPDRVEKLVAIDIAPVNYQVRRHDTIFAALNAVSAAGVTQRNEAAQLMRTLI-KEEGVI 159
170025208  81 TQAIIIGHSMGGKVAMAMTALAPNRVEKLVAIDIAPVNYQVRRHDTIFAALNAVSAAGVTQRNEAAQLMRTLI-KEEGVI 159
186894507  81 TQAIIIGHSMGGKVAMAMTALAPNRVEKLVAIDIAPVNYQVRRHDTIFAALNAVSAAGVTQRNEAAQLMRTLI-KEEGVI 159
123443184  81 KKAIIIGHSMGGKVAMAMTAIAPDRIEKLIAIDVAPIDYQVRRHDQIFTAINAVSAAGVTQRQEAAQLMRESI-KEEGVI 159
253990485  85 QSAIIIGHSMGGKIAMTMTALAPERIEKIILIDIAPVAYQVRRHDKIFTALNKVTEAGVKTRQDAIKIMREDI-QEEGVI 163
242238567 165 QFLLKSFQQGEWRFNVPVLWDQYENIVGWQEIPAWHGPILFIRGGNSPYLDDRYRGALLRQFPQAKAHVVNGAGHWVHAE 244
290474130 164 QFLLKSFRQGEWKFNLPVLRKEYEKIIGWEAIPAWPKPALFIRGGNSDYITEAYREDIMRQFPQATAWVIAGCGHWVHAE 243
300722362 164 QFLLKSFRQGEWKFNLPVLQQEYEKIISWETIPAWHKPVLFIRGGNSDYITEEYRDDIIRQFPQATAWVIAGSGHWVHAE 243
294504439 160 QFLLKSFQGGEWRFNVPALWDQYENIIGWQPIPPWPHPILFIRGELSPYIQDSYRDDIARQFPQARAHVVAGTGHWVHAE 239
51595475  160 QFLLKSFQGGEWRFNVPALWDQYENIIGWQPIPPWPHPILFIRGELSPYIQDSYRDDIARQFPQARAHVVAGTGHWVHAE 239
153949154 160 QFLLKSFQGGEWRFNVPALWDQYENIIGWQPIPPWPHPILFIRGELSPYIQDSYRDDIARQFPQARAHVVAGTGHWVHAE 239
170025208 160 QFLLKSFQGGEWRFNVPALWDQYENIIGWQPIPPWPHPILFIRGELSPYIQDSYRDDIARQFPQARAHVVAGTGHWVHAE 239
186894507 160 QFLLKSFQGGEWRFNVPALWDQYENIIGWQPIPPWPHPILFIRGELSPYIQDSYRDDIARQFPQARAHVVAGTGHWVHAE 239
123443184 160 QFLLKSFHNGEWRFNVPALWDQYENIVGWQPIPPWPHPILFIRGELSPYIQDSYRDEIARQFPQARAHVVAGTGHWVHAE 239
253990485 164 QFLLKSFRQGEWKFNLPILINQYEKIIGWQEIPAWPHPALFIRGGLSPYIQEEYRDDIVRQFPQAKAWVITGCGHWVHSE 243
242238567 245 KPDAVLRVVNRFLNDD 260
290474130 244 KPEAVLRAIHRFLAKK 259
300722362 244 KPEAVLRAIHRFL--- 256
294504439 240 KPDSVLRAIHRFLDAA 255
51595475  240 KPDSVLRAIHRFLDAA 255
153949154 240 KPDSVLRAIHRFLDAA 255
170025208 240 KPDSVLRAIHRFLDAA 255
186894507 240 KPDSVLRAIHRFLDAA 255
123443184 240 KPDSVLRAIHRFIDEE 255
253990485 244 KPDAVLRAIHRFLNTD 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap