Conserved Protein Domain Family
PRK10651

?
PRK10651: PRK10651 
transcriptional regulator NarL; Provisional
Statistics
?
PSSM-Id: 182619
View PSSM: PRK10651
Aligned: 83 rows
Threshold Bit Score: 313.504
Threshold Setting Gi: 197287372
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113970560   6 ITEEDKATILLIDDHPMLRNGVKQLIGMADNLCIVAEASCGKDGIILATQLDPDLILLDLNMPEFNGLETLTKLRECELS 85
gi 114047794   6 ITEEDKATILLIDDHPMLRNGVKQLIGMADNLCIVAEASCGKDGIILATQLDPDLILLDLNMPEFNGLETLTKLRECELS 85
gi 196158648   1 MFEDKPATIMMVDDHPLLRKGLNQLIEFEDDLEVIGEASSGKEAIEMAVQLEPDLITLDLNMQGMDGLETLKHLRDKGVD 80
gi 116051915   6 ATADEPVRLLLVDDHPMMRKGVAQLLELEDDLSVVGEAGSGEEALRLAAELDPDMILLDLNMKGMNGLDTLRALREAGVD 85
gi 15599074    6 ATADEPVRLLLVDDHPMMRKGVAQLLELEDDLSVVGEAGSGEEALRLAAELDPDMILLDLNMKGMNGLDTLRALREAGVD 85
gi 152984552   6 ATADEPVRLLLVDDHPMMRKGVAQLLELEDDLSVVGEAGSGEEALRLAAALDPDMILLDLNMKGMNGLDTLRALREAGVD 85
gi 218889841   6 ATADEPVRLLLVDDHPMMRKGVAQLLELEDDLSVVGEAGSGEEALRLAAELDPDMILLDLNMKGMNGLDTLRALREAGVD 85
gi 74317417    1 MPTTDPQTILIVDDHPLFRKGVIQLIQAAPEFRFVGEAASGGEGLTLAHRLHPDMILLDLNMKDMNGVEVLKAIKDEGLD 80
gi 56459293    1 -MTTEAASIMLVDDHPLLRKGLKQLIAMEDDMTVVAEASNGPDALLLAVEHDPDLIVLDLNMQGMDGIETLKRLRDSGVT 79
gi 83646727    1 --MSEKATIMMVDDHPLFRKGIRQLIELEEELDIVAEAKNGEEGLSKAKELEPDLILLDLNMQGMDGLDTLRAIRAAGVD 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113970560  86 SRIIVFTVSNYEGDIVNAFKYGADGYLLKDMEPEDLLQSIQQAAAGKIVLSDAIAPILATGLRHNPPATKRDIESLTARE 165
gi 114047794  86 SRIIVFTVSNYEGDIVNAFKYGVDGYLLKDMEPEDLLQSIQQAAAGKIVLSDAIAPILATGLRHNPPATKRDIESLTARE 165
gi 196158648  81 SRIIMLTVSDNDEDVVEAVRSGADGYLLKDMDPEDIVDKLREAALGKMVMSAKLTEVLATALRKPERAGSRALASLTSRE 160
gi 116051915  86 ARIVVFTVSDDKGDVVNVLRAGADGYLLKDMEPERLLEHIRQAATGQMTLSPQLTQILAQALRGDDRS--KSLDELTERE 163
gi 15599074   86 ARIVVFTVSDDKGDVVNVLRAGADGYLLKDMEPERLLEHIRQAATGQMTLSPQLTQILAQALRGDDRS--KSLDELTERE 163
gi 152984552  86 ARIVVFTVSDDKGDVVNVLRAGADGYLLKDMEPERLLEHIRQAATGQMTLSPQLTQILAQALRGDDRS--KSLDELTERE 163
gi 218889841  86 ARIVVFTVSDDKGDVVNVLRAGADGYLLKDMEPERLLEHIRQAATGQMTLSPQLTQILAQALRGDDRS--KSLDELTERE 163
gi 74317417   81 SRVIMLTVSDQAEDLIAALQAGADGYLLKDMEPEDLMQQLAEAARGKITISEGLTQLLVSSLREKTRPTSLADAGLTEQE 160
gi 56459293   80 SRIIMLTVSDADDDVVAAITNGADGYLLKDMEPELLLEQIHRAVTGKMVLSEAITEILATALRQPTQSTTSQLSNLTNRE 159
gi 83646727   79 SRIIMLTVSDNEADVVNCFRAGADGYLLKDMEPEDILEKIKQVTLGKMAISERLTEILASALRKPVEAADPSAS-LTSRE 157
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 113970560 166 KDIIRLVSQGLSNKMIARKLIITEGTVKVHVKNLLKKLSFKSRVEATVWILQENIF 221
gi 114047794 166 KDIIRLVSQGLSNKMIARKLIITEGTVKVHVKNLLKKLSFKSRVEATVWILQENIF 221
gi 196158648 161 LEILKLIAKGMSNKLIARELDISDGTVKVHVKHFLKKLNLRSRVEAAVWMVNHQKG 216
gi 116051915 164 RQILRQIAHGYSNKMIARKLDITEGTVKVHVKRVLHKLGMRSRVEAAVWAVENDLV 219
gi 15599074  164 RQILRQIAHGYSNKMIARKLDITEGTVKVHVKRVLHKLGMRSRVEAAVWAVENDLV 219
gi 152984552 164 RQILRQIAHGYSNKMIARKLDITEGTVKVHVKRVLHKLGMRSRVEAAVWAVENDLV 219
gi 218889841 164 RQILRQIAHGYSNKMIARKLDITEGTVKVHVKRVLHKLGMRSRVEAAVWAVENDLV 219
gi 74317417  161 NRILDHLVDGKSNKLIARDMGIAEGTVKVHVKHLLKKLNLRSRVEAAVWADRCRRQ 216
gi 56459293  160 HEILSLIAKGMSNKVIARELDISDGTVKVHVKHLLKKLGLRSRVEAAVWMVNLQGN 215
gi 83646727  158 YEILTRIAQGHSNKVIARDLNISDGTVKVHVKHILKKMGMRSRVEAAVWLVNRKG- 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap