Conserved Protein Domain Family
PRK10188

?
PRK10188: PRK10188 
DNA-binding transcriptional activator SdiA; Provisional
Statistics
?
PSSM-Id: 182292
View PSSM: PRK10188
Aligned: 57 rows
Threshold Bit Score: 443.073
Threshold Setting Gi: 152970958
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156933489   1 MKESDFFNWRREMTTRFQEIQDSSDIYSLLKTETQNMEYDYFALCVRHPVPFTRPKLTLHTTYPEAWLEHYQAENYYVID 80
gi 296101736   1 MKDSDFFTWRRDCFLRFQALTSASEVYQELQRQTQALEFDYYALCLRHPVPFTRPRISVHATYPQRWMAQYQSENYFAID 80
gi 146312149   1 MRETDFFTWRRNCFLRFQEMGSADEVYEELQRQTQALEFDYYSLCVRHPVPFTRPKISIHSSYPAEWISQYQSENYYAID 80
gi 152970958   1 ------------MLHQFQSMATGEEVYNLLQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMSHYQAENYFAID 68
gi 288934569   1 MRDNDFFSWRRDMLHQFQSVAAGEEVYNLLQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMSHYQAENYFAID 80
gi 238895474   1 MRDNDFFSWRRDMLHQFQSMATGEEVYNLLQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMSHYQAENYFAID 80
gi 161502928  12 MQENDFFTWRRAMLLRFQEMATAEGVYTELQYQTQRLEFDYYSLCVRHPVPFTRPKISLRTTYPQAWVTHYQAENYIAID 91
gi 197362061   1 MQENDFFTWRRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPQAWVTHYQSENYFAID 80
gi 29141412    1 MQENDFFTWRRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPQAWVTHYQSENYFAID 80
gi 16760896    1 MQENDFFTWRRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPQAWVTHYQSENYFAID 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156933489  81 PVLKPANYLVGPLSWNDALFAgAAEELWNAARDHGLVKGVTQCVIAPNRAQGFLSVSGTSPRGHSMADDELALRLQHLVE 160
gi 296101736  81 PVLKPENFIQGHLPWTDELFA-DAEALWNGARDHGLRKGITQCLMLPNHALGFLSVSCTSVQAGAVTSEELELRLQMLLQ 159
gi 146312149  81 PVLKRENFLQGHLPWTDALFA-DAQALWDGARDHGLRKGITQCLMLPNHALGFLSVSRTSQFGKMMDSDEIELRLQVLVQ 159
gi 152970958  69 PVLRPENFMRGHLPWNDSLFR-DAPALWDGARDHGLQKGVTQCLTLPNHAQGFLSVSANNRLPGGYPEDELELRLRTLTE 147
gi 288934569  81 PVLRPENFMRGHLPWEDGLFR-DAAALWEGARDHGLKKGVTQCLTLPNHAQGFLSVSANNRLPGSYPDDELEMRLRMLTE 159
gi 238895474  81 PVLRPENFMRGHLPWNDSLFR-DAPALWDGARDHGLQKGVTQCLTLPNHAQGFLSVSANNRLPGGYPEDELELRLRTLTE 159
gi 161502928  92 PVLKPENFREGHLHWDNVLFH-EAQAMWDAAQRFGLRRGVTQSVMLPNRAVGFLSVSRGSLGCSSFTYDEVELRLQLLAR 170
gi 197362061  81 PVLKPENFRQGHLHWDDVLFH-EAQAMWDAAQRFGLRRGVTQCVMLPNRALGFLSFSRSSLRCSSFTYDEVELRLQLLAR 159
gi 29141412   81 PVLKPENFRQGHLHWDDVLFH-EAQAMWDAAQRFGLRRGVTQCVMLPNRALGFLSFSRSSLRCSSFTYDEVELRLQLLAR 159
gi 16760896   81 PVLKPENFRQGHLHWDDVLFH-EAQAMWDAAQRFGLRRGVTQCVMLPNRALGFLSFSRSSLRCSSFTYDEVELRLQLLAR 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156933489 161 QSLVTMMRLEDPAATVLEMKLSKREKEILQWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAAIGL 240
gi 296101736 160 MALTSLLRFEDEMVMPPEMKFSKREREILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGL 239
gi 146312149 160 MALTTLLRFEHEMVMPPEMKFSKREKEILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGF 239
gi 152970958 148 LSLLTLLRLEDEMVMPPEMKFSRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGL 227
gi 288934569 160 LSLLALLRLEDEMVMPPEMKFSRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGL 239
gi 238895474 160 LSLLTLLRLEDEMVMPPEMKFSRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGL 239
gi 161502928 171 ESLSALTRLEDDIVMVPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGL 250
gi 197362061 160 ESLSALTRFEDDMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGL 239
gi 29141412  160 ESLSALTRLEDDMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGL 239
gi 16760896  160 ESLSALTRLEDDMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGL 239

                 .
gi 156933489 241 I 241
gi 296101736 240 I 240
gi 146312149 240 I 240
gi 152970958 228 I 228
gi 288934569 240 I 240
gi 238895474 240 I 240
gi 161502928 251 I 251
gi 197362061 240 I 240
gi 29141412  240 I 240
gi 16760896  240 I 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap