Conserved Protein Domain Family
PRK10100

?
PRK10100: PRK10100 
DNA-binding transcriptional regulator CsgD; Provisional
Statistics
?
PSSM-Id: 182241
View PSSM: PRK10100
Aligned: 58 rows
Threshold Bit Score: 329.524
Threshold Setting Gi: 152971901
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157146272   1 MFN-EVHSIHGHTLLLITKPSLQATALLQHLKQSLAVTGKLHNIQRSLDD-ISASCIVLLDMMEADKKIIHYWQDNLSRK 78
gi 283784837   1 MYN-EVHSIHGHTLLLITKPSLQATALLQHLKQSLAVSGKLHNIQRSLDD-IPAGSIVLVDMMEADKKLIHYWQENLARK 78
gi 146311212   1 MFN-EVHSLQGHTLLLITKPSLQATALLQHLKQSLCLNGKLHNIQRSFDD-IVPGSIILFDMMEADKKLIHYWQDNLSRK 78
gi 296102946   1 MYN-EVHSLHGHTLLLITKPSLQATALLQHLKQSLSLNGKLHNIQRSFDD-IAPGSIILFDMMEADKKLIHYWQDTLSRK 78
gi 152971901   1 MINlNGNSSSSRQVTFITHPSIQSKAFASYLSETLMAPVVLQNINKPLAQrLAKDSVILFDIAVSNKKLNGVWRDIIRLQ 80
gi 238896480   1 MINlNGNSSSSRQVTFITHPSIQSKAFASYLSETLMAPVVLQNINKPLAQrLAKDSVILFDIAVSNKKLNGVWRDIIRLQ 80
gi 206577986   1 MINlNGNSSSSRQVTFITHPSIQSKAFASYLSETLMAPVVLQNINKPLAQrLAKDSVILFDIAVSNKKLNGVWRDIIRLQ 80
gi 56413870    1 MFN-EVHSSHGHTLLLITKPSLQATALLQHLKQSLAITGKLHNIQRSLED-ISASCIVLMDMMEADKKLIHYWQDNLSRK 78
gi 197362793   1 MFN-EVHSSHGHTLLLITKPSLQATALLQHLKQSLAITGKLHNIQRSLED-ISASCIVLMDMMEADKKLIHYWQDNLSRK 78
gi 194444624   1 MFN-EVHSSHGHTLLLITKPSLQATALLQHLKQSLAITGKLHNIQRSLED-ISASCIVLMDMMEADKKLIHYWQDNLSRK 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157146272  79 NNNIKTLLLNTPDDYPFRDIENWPHINGVFYATEDEERVVNGLQGILRGECYFSQKLASYLITHSGNYRYNST----ESA 154
gi 283784837  79 NNNIRTLLLNTPEDYPYRDIESWPHINGVFYVTEDEERVVYGLQGILRGECYFSQKLASYLITHSGNYRYNGT----ESA 154
gi 146311212  79 NNNIRALLLNTPDEYPFRDIESWPHINGVFYVTEDETHVVEGLQGILRGECYFSQKLASYLITHSGNYRYNSS----ESA 154
gi 296102946  79 NNNIRVLLLNTPDEYPFRDIESWPHINGVFYVTEEENRVVEGLQGILRGECYFSQKLASYLITHSGNYRYNSS----ESA 154
gi 152971901  81 ADNPRLLIINSAQKYELYEMAQWPALYGVFRHDDDESRLIEGVKAVLNGE-----QTAELSVMHPAMYAADHAstpvENS 155
gi 238896480  81 ADNPRLLIINSAQKYELYEMAQWPALYGVFRHDDDESRLIEGVKAVLNGE-----QTAELSVMHPAMYAADHAstpvENS 155
gi 206577986  81 ADNPRLLIINSAQKYELYEMAQWPALYGVFRHDDDESRLIEGVKAVLNGE-----QTAELSVMHPAMYAADHAsapvENS 155
gi 56413870   79 NNNIKTLLLNTPDDYPYREIENWPHINGVFYATEDQEHVVSGLQGILRGECYFSQKLASYLITHSGNYRYNST----ESA 154
gi 197362793  79 NNNIKTLLLNTPDDYPYREIENWPHINGVFYATEDQEHVVSGLQGILRGECYFSQKLASYLITHSGNYRYNST----ESA 154
gi 194444624  79 NNNIKTLLLNTPDDYPYREIENWPHINGVFYATEDQEHVVSGLQGILRGECYFSQKLASYLITHSGNYRYNST----ESA 154
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 157146272 155 LLTHREKEILNKLRIGASNIEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR 216
gi 283784837 155 LLTHREKEILNKLRIGASNIEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR 216
gi 146311212 155 LLTHREKEILNKLRIGSSNIEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR 216
gi 296102946 155 LLTHREKEILNKLRIGASNIEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR 216
gi 152971901 156 PLTERECEILNELRCGATNLDIARALFISENTVRTHLYNVFRKLSVKNRTQAVSWANEHLRH 217
gi 238896480 156 PLTERECEILNELRCGATNLDIARALFISENTVRTHLYNVFRKLSVKNRTQAVSWANEHLRH 217
gi 206577986 156 PLTERECEILNELRCGATNLDIARALFISENTVRTHLYNVFRKLSVKNRTQAVSWANEHLRH 217
gi 56413870  155 LLTHREKEILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR 216
gi 197362793 155 LLTHREKEILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR 216
gi 194444624 155 LLTHREKEILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR 216
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap