Conserved Protein Domain Family
PRK10070

?
PRK10070: PRK10070 
glycine betaine transporter ATP-binding subunit; Provisional
Statistics
?
PSSM-Id: 182221
View PSSM: PRK10070
Aligned: 53 rows
Threshold Bit Score: 729.139
Threshold Setting Gi: 157162128
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157148216   1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILDKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
283786768   1 MAIKLEVKNLYKVFGEHPQRAFKYIEKGFSKEQILEKTGLSLGVKNASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
146312798   1 MAIKLEVKNLYKVFGDNPQRAFKYIEKGLSKELILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
198245385   1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
194442245   1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
62181313    1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
207858078   1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
205353759   1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
194450407   1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
194736663   1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP 80 
157148216  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGVAAEERREKALDALRQVGLENYAHG 160
283786768  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAEERREKALDALRQVGLENYAQA 160
146312798  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIPAAERQEKALDALRQVGLENYAHG 160
198245385  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHA 160
194442245  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHA 160
62181313   81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHA 160
207858078  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHA 160
205353759  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHA 160
194450407  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHA 160
194736663  81 TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHA 160
157148216 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTVVFISHDLDEAMRIGDRIAIMQN 240
283786768 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
146312798 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTVVFISHDLDEAMRIGDRIAIMQN 240
198245385 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
194442245 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
62181313  161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
207858078 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
205353759 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
194450407 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
194736663 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240
157148216 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREFGYVIERGNKF 320
283786768 241 GEVVQVGTPDEILNSPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKY 320
146312798 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRALNGIIRRTPGFGPRSALKLLQDEDREYGYVIERGNKY 320
198245385 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKF 320
194442245 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKF 320
62181313  241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKF 320
207858078 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKF 320
205353759 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKF 320
194450407 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKF 320
194736663 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKF 320
157148216 321 VGIVSIDSLKAALSQAQGIEAALIDESLAVDAQTPLSELLSHVGQAPCAVPVVDEEQQYVGIISKRMLLQALDREGANNG 400
283786768 321 VGVVSIDSLKTALSQAQGIDGALIDEPLAVDAQTPLSELLSHVGQAPCAVPVVDEEQQYVGIISKRMLLQALDREGANNG 400
146312798 321 VGIVSIDSLKSALSENLGIDAALIDAPLAVDAETPLSELLSHVGQAPCAVPVIGEEQQYVGIISKRMLLQALDREGANNG 400
198245385 321 VGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNNG 400
194442245 321 VGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNNG 400
62181313  321 VGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNNG 400
207858078 321 VGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNNG 400
205353759 321 VGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNNG 400
194450407 321 VGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNNG 400
194736663 321 VGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNNG 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap