Conserved Protein Domain Family
sufC

?
PRK09580: sufC 
cysteine desulfurase ATPase component; Reviewed
Statistics
?
PSSM-Id: 181965
View PSSM: PRK09580
Aligned: 93 rows
Threshold Bit Score: 471.968
Threshold Setting Gi: 218709890
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145962   1 MLSIKDLQVSVEDKAILRGLDLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVVGGSVEFKGKDLLELSPEDRAGEGI 80
gi 294503594   1 MLSIKNLKVSVEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEGEVTFKGKDLLELAPEDRAGEGV 80
gi 51596636    1 MLSIKNLKVSVEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEGEVTFKGKDLLELAPEDRAGEGV 80
gi 153947283   1 MLSIKNLKVSVEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEGEVTFKGKNLLELAPEDRAGEGV 80
gi 170024088   1 MLSIKNLKVSVEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEGEVTFKGKDLLELAPEDRAGEGV 80
gi 186895692   1 MLSIKNLKVSVEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEGEVTFKGKDLLELAPEDRAGEGV 80
gi 123442431   1 MLSIKNLKVSVEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEGSVTFKGKDLLELDPEARAGEGV 80
gi 253688825   1 MLSIENLKVSVEGKEIIKGLNLTIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTDGSVDFKGKDLLELSPEDRAGEGV 80
gi 50120791    1 MLSIENLKVSVEGKEIIKGLNLTIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTDGSVSFKGKDLLELSPEDRAGEGV 80
gi 261822005   1 MLSIENLKVSVEGKEIIKGLNLTIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTDGSVSFKGKDLLELSPEDRAGEGV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145962  81 FMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQESLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMA 160
gi 294503594  81 FLAFQYPVEIPGVSNHFLLQTSVNAVRKYRQQAPLDRFDFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMA 160
gi 51596636   81 FLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQAPLDRFDFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMA 160
gi 153947283  81 FLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQAPLDRFDFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMA 160
gi 170024088  81 FLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQAPLDRFDFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMA 160
gi 186895692  81 FLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQAPLDRFDFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMA 160
gi 123442431  81 FLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRFDFADFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMA 160
gi 253688825  81 FMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEPLDRFDFADFIEEKIKLLNMPEDLLTRSVNVGFSGGEKKRNDILQMA 160
gi 50120791   81 FMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEPLDRFDFADFIEEKIKLLNMPEDLLTRSVNVGFSGGEKKRNDILQMA 160
gi 261822005  81 FMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEPLDRFDFADFIEEKIKLLNMPEDLLTRSVNVGFSGGEKKRNDILQMA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145962 161 VLEPELCILDESDSGLDIDALKIVAEGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQG 240
gi 294503594 161 ALEPSLCILDETDSGLDIDALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEEQG 240
gi 51596636  161 ALEPSLCILDETDSGLDIDALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEEQG 240
gi 153947283 161 ALEPSLCILDETDSGLDIDALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEEQG 240
gi 170024088 161 ALEPSLCILDETDSGLDIDALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEEQG 240
gi 186895692 161 ALEPSLCILDETDSGLDIDALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEEQG 240
gi 123442431 161 ALEPSLCILDETDSGLDIDALKIVANGVNSLRNQDRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEEQG 240
gi 253688825 161 ALEPDLCILDETDSGLDIDALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFSLVKQLEEQG 240
gi 50120791  161 ALEPDLCILDETDSGLDIDALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFSLVKQLEEQG 240
gi 261822005 161 ALEPDLCILDETDSGLDIDALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFSLVKQLEEQG 240

                 ....*...
gi 157145962 241 YGWLTEQQ 248
gi 294503594 241 YGWLTDQQ 248
gi 51596636  241 YGWLTDQQ 248
gi 153947283 241 YGWLTDQQ 248
gi 170024088 241 YGWLTDQQ 248
gi 186895692 241 YGWLTDQQ 248
gi 123442431 241 YGWLTDQQ 248
gi 253688825 241 YGWLTDGQ 248
gi 50120791  241 YGWLTDEQ 248
gi 261822005 241 YGWLTDGQ 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap